DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and CG14667

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:352 Identity:89/352 - (25%)
Similarity:147/352 - (41%) Gaps:63/352 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCGLFIF-CSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQTAIAFRE 69
            ||.|...|. .....|:|.......|.|::::||:.|....|  ||..:|..|..:|..|..|||
  Fly     7 CRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQG--LPEIVCERCFSELDLATKFRE 69

  Fly    70 RVIRTQKTLQESPNLGNAELIESFAVGVEKEIQYAEEVTEIEVIDL-----------------LP 117
            |.|.:||.|        .::|:..:......::.:.|..:.::||.                 ..
  Fly    70 RCIFSQKYL--------LDIIKKTSDQSTVHVELSSEPLDEQLIDADQLETHYDDDQYVCYQGTK 126

  Fly   118 EEHLLEETEEPYEICEQNEQPQVKVPAQEKKLRRSTKTTPTVFTSVKFADNSQATRTQWSRLTED 182
            |||  ::.||    .|.::.|...|.|                     |..:.|...|...|.|.
  Fly   127 EEH--QDLEE----IELDDDPSAAVIA---------------------AAEAAAEAAQQEDLQEQ 164

  Fly   183 EVVALKRERRKRDCICEQCGRHFTCPSNFKLHLLRHTGVKS----FACDQCSQQFYTATLLRRHQ 243
            |:....: ||....||::||..|.....:..||..|...:.    |.|.:|.|.|....||::|:
  Fly   165 EMERAAK-RRSNFFICDECGTLFHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHR 228

  Fly   244 -ELHAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHT-GV 306
             ::|..|..|||..|...:::...:::|:: .|.|.:|:.|.||...|:...:|:.|..:|: .:
  Fly   229 TQVHLINRRFQCTICHEAFASLGAKLRHDK-AHKNERPYPCLECGMIFSSVSELQNHFSTHSKQI 292

  Fly   307 RAFHCDSCQVSFVRRSHLTSHYRSKGH 333
            |.|.|:.|.:.|:.|..|.:|.::..|
  Fly   293 RKFRCEPCNMDFITRRGLVAHTKTAPH 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 26/74 (35%)
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
C2H2 Zn finger 226..243 CDD:275368 6/16 (38%)
C2H2 Zn finger 254..275 CDD:275368 3/20 (15%)
zf-C2H2 281..303 CDD:278523 6/21 (29%)
C2H2 Zn finger 283..303 CDD:275368 6/19 (32%)
zf-H2C2_2 296..320 CDD:290200 8/24 (33%)
C2H2 Zn finger 311..329 CDD:275368 6/17 (35%)
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 26/82 (32%)
C2H2 Zn finger 179..199 CDD:275368 6/19 (32%)
C2H2 Zn finger 211..232 CDD:275368 7/20 (35%)
C2H2 Zn finger 240..260 CDD:275368 3/20 (15%)
zf-C2H2_8 243..313 CDD:292531 19/70 (27%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 297..316 CDD:275368 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.