DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and D19A

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_477304.1 Gene:D19A / 38718 FlyBaseID:FBgn0022935 Length:845 Species:Drosophila melanogaster


Alignment Length:166 Identity:48/166 - (28%)
Similarity:69/166 - (41%) Gaps:29/166 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 RDCICEQCGRHFTCPSNFKLHLLRHTGVK-SFACDQCSQQFYTATLLRRHQELHAG--------- 248
            ||..|.:|...|.||:..|.|:.:|||.: .:.|:.|.::|...:.||.|...|||         
  Fly   373 RDFPCTECDTVFRCPTALKKHMYKHTGEELPYPCNICGKRFVINSALRDHLMRHAGIKNHVCPYC 437

  Fly   249 ----------NA---------LFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSG 294
                      ||         .|:||.|:....|......|.::.|...|.|.|:.|.|:|..|.
  Fly   438 GVGKTTRQEWNAHILTHTKEKKFKCRQCDHASHNKQALSNHVKVVHEKRKDFACQYCGKTFGKSH 502

  Fly   295 KLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRS 330
            ..:.|..||||.:...|..|...|:....||.|.::
  Fly   503 ACKVHERSHTGEKCCECKICGKIFLCEKSLTKHLKT 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)
C2H2 Zn finger 226..243 CDD:275368 5/16 (31%)
C2H2 Zn finger 254..275 CDD:275368 5/20 (25%)
zf-C2H2 281..303 CDD:278523 7/21 (33%)
C2H2 Zn finger 283..303 CDD:275368 6/19 (32%)
zf-H2C2_2 296..320 CDD:290200 8/23 (35%)
C2H2 Zn finger 311..329 CDD:275368 6/17 (35%)
D19ANP_477304.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 343..362 CDD:275368
C2H2 Zn finger 377..397 CDD:275368 7/19 (37%)
zf-H2C2_2 389..414 CDD:290200 7/24 (29%)
C2H2 Zn finger 406..426 CDD:275368 6/19 (32%)
C2H2 Zn finger 434..454 CDD:275368 2/19 (11%)
C2H2 Zn finger 462..483 CDD:275368 5/20 (25%)
C2H2 Zn finger 491..511 CDD:275368 6/19 (32%)
C2H2 Zn finger 519..539 CDD:275368 6/20 (30%)
C2H2 Zn finger 652..673 CDD:275368
C2H2 Zn finger 681..701 CDD:275368
zf-H2C2_2 694..718 CDD:290200
C2H2 Zn finger 709..729 CDD:275368
tolA_full 724..>814 CDD:274303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.