DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and D19B

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster


Alignment Length:502 Identity:98/502 - (19%)
Similarity:158/502 - (31%) Gaps:181/502 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCGLFIFCSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQTAIAFRER 70
            ||||...:..|...:||..|.  :..::.|.|.|.:....|  .|..:|:.|...|.....|:::
  Fly    13 CRTCLSTVDDSAAYDLFRVPG--LAKKLCVCTSLSVEQADG--FPKNLCNVCFSKLNDLHDFQKQ 73

  Fly    71 VIRTQKTLQ-----------------------------ESPNL-------GNAELIES------F 93
            .:.:.:..|                             |..|:       ...|:||:      .
  Fly    74 CVDSVQKFQDLVASNAFACQTNFDVLDTSAAVADLPGEEEDNVHFDPLLNSKIEIIENEEDVFKM 138

  Fly    94 AVGVEKEIQYAEEVTE-------------------------IEVIDLLP---------------- 117
            ...||||::..|...|                         |...|.:|                
  Fly   139 LESVEKEVEEVEMEMEQPFGRVSQDDSFESGNDNDLDADFQISSDDDIPLAQRSRRGATRGSKAK 203

  Fly   118 ---------EEHLLEETEEPYEICEQNEQPQVK-----VPAQEK-------------KLRRSTKT 155
                     :|...||:||.....:.:..|:.|     :||.|:             |.:::.:.
  Fly   204 GKPKSAAKRQEEESEESEETSSSDDSDGNPKDKPKRKRIPATERDRHRLIDCHICHQKFKKAIRY 268

  Fly   156 TP-------------TVFTSVKFADNSQATRTQWSRL-TEDEVV--------------------A 186
            ..             ||.:..|....:...|...... ||...:                    .
  Fly   269 EEHMKHHNDLLPFQCTVESCRKGFTTANGLRVHVEHAHTETSAMHPCTYEGCNKSFARPVLLSFH 333

  Fly   187 LKRERR----KRDCICEQCGRHFTCPSNFKLHLLRHTGVK-SFACDQCSQQFYTATLLRRHQELH 246
            :||..:    :||..|.:|.:.|.||:..|.|:.:|||.: .|||:.|.::|...::||.|...|
  Fly   334 MKRVHKVDTPQRDFPCTECEKVFRCPTALKKHMYKHTGEELPFACEICGKRFPINSVLRDHLLRH 398

  Fly   247 AG----------------------------NALFQCRYCEATYSNASGRIQHERMRHTNVKPFTC 283
            ||                            ...::||.|:....|......|.::.|...|.|.|
  Fly   399 AGIKNHVCPYCGVGKTTRQEWNKHILTHTKEKKYECRQCDHASHNKQALANHVKVVHEKRKDFAC 463

  Fly   284 KECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRS 330
            :.|.|:|..|...:.|..||||.:...|..|...|:....||.|.::
  Fly   464 QYCGKTFGKSHACKIHERSHTGEKCCECKICGKVFLFEKGLTKHLKT 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 18/102 (18%)
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)
C2H2 Zn finger 226..243 CDD:275368 5/16 (31%)
C2H2 Zn finger 254..275 CDD:275368 5/20 (25%)
zf-C2H2 281..303 CDD:278523 7/21 (33%)
C2H2 Zn finger 283..303 CDD:275368 6/19 (32%)
zf-H2C2_2 296..320 CDD:290200 8/23 (35%)
C2H2 Zn finger 311..329 CDD:275368 6/17 (35%)
D19BNP_477297.1 zf-AD 12..83 CDD:214871 17/73 (23%)
C2H2 Zn finger 255..275 CDD:275368 1/19 (5%)
C2H2 Zn finger 283..335 CDD:275368 6/51 (12%)
C2H2 Zn finger 318..338 CDD:275368 2/19 (11%)
COG5048 <347..512 CDD:227381 45/164 (27%)
C2H2 Zn finger 349..369 CDD:275368 7/19 (37%)
C2H2 Zn finger 378..398 CDD:275368 6/19 (32%)
C2H2 Zn finger 406..426 CDD:275368 0/19 (0%)
C2H2 Zn finger 434..455 CDD:275368 5/20 (25%)
C2H2 Zn finger 463..483 CDD:275368 6/19 (32%)
C2H2 Zn finger 491..511 CDD:275368 6/20 (30%)
C2H2 Zn finger 586..607 CDD:275368
C2H2 Zn finger 615..635 CDD:275368
zf-H2C2_2 627..652 CDD:290200
C2H2 Zn finger 643..663 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.