DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and CG10274

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001097525.1 Gene:CG10274 / 38716 FlyBaseID:FBgn0035690 Length:863 Species:Drosophila melanogaster


Alignment Length:215 Identity:61/215 - (28%)
Similarity:82/215 - (38%) Gaps:29/215 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 TEDEVV-----ALKRERRKRD-----CICEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFY 234
            ||.|.|     |||:...|.|     ..|..||:.|...|..|.||:||.|:|::.|..|.....
  Fly   369 TECEKVFRCPMALKKHMYKHDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKT 433

  Fly   235 TATLLRRHQELHAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTH 299
            |......|...|.....|:|..||....|......|.::.|..:|.:.|:.|.|:|..|...:.|
  Fly   434 TRQEWNTHILTHTQEKKFKCHICEHASHNKQSLANHIKIVHEKIKNYACQYCGKTFGKSHACKIH 498

  Fly   300 MLSHTGVRAFHCDSCQVSFVRRSHLTSH--------------YRSKGHAHTSSAQAALDN----P 346
            .::|||.:...|..|...|:....||.|              ||.:......:.....||    |
  Fly   499 EMTHTGEKRCECKVCGKKFLYPKSLTKHLKTHEKRVLRAIETYRQRQVEMGETPGEQFDNPPAPP 563

  Fly   347 VELDVKASNGMQTGAKDEAL 366
            || .:.....|...|.||.|
  Fly   564 VE-GISIEPIMSRNAADELL 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 8/19 (42%)
C2H2 Zn finger 226..243 CDD:275368 3/16 (19%)
C2H2 Zn finger 254..275 CDD:275368 5/20 (25%)
zf-C2H2 281..303 CDD:278523 6/21 (29%)
C2H2 Zn finger 283..303 CDD:275368 6/19 (32%)
zf-H2C2_2 296..320 CDD:290200 7/23 (30%)
C2H2 Zn finger 311..329 CDD:275368 6/31 (19%)
CG10274NP_001097525.1 zf-AD 15..90 CDD:214871
C2H2 Zn finger 334..353 CDD:275368
C2H2 Zn finger 368..388 CDD:275368 7/18 (39%)
COG5048 394..729 CDD:227381 52/190 (27%)
C2H2 Zn finger 397..417 CDD:275368 8/19 (42%)
C2H2 Zn finger 425..445 CDD:275368 4/19 (21%)
C2H2 Zn finger 453..474 CDD:275368 5/20 (25%)
C2H2 Zn finger 482..502 CDD:275368 6/19 (32%)
C2H2 Zn finger 510..530 CDD:275368 6/19 (32%)
C2H2 Zn finger 638..659 CDD:275368
C2H2 Zn finger 667..687 CDD:275368
zf-H2C2_2 680..704 CDD:290200
C2H2 Zn finger 695..715 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.