DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and Kah

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster


Alignment Length:262 Identity:61/262 - (23%)
Similarity:103/262 - (39%) Gaps:49/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 KKLRRSTKTTPTVFTSVKFADNSQATRTQWSRLTEDEVVALKRERR------------------K 193
            :||||.     |:..|...|.:|.::.:  ||.:.::.:.|:....                  :
  Fly    59 RKLRRC-----TISDSNSCASSSSSSTS--SRQSSEDHLGLQGHSSVHHHHGEQGEILNSTSLLE 116

  Fly   194 RDCICEQCGRHFTCPSNFKLHLLRHTGV---KSFACDQCSQQFYTATLLRRHQELHAGNALFQCR 255
            .:.||.:||:.::..||...|...|..:   |:..|..|.:.:.:......|...|  |...:|:
  Fly   117 DEHICPECGKKYSTSSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTH--NQGCECQ 179

  Fly   256 YCEATYSN---ASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVS 317
            :|...:|.   ..|.|:    .||..|||.|..|.|:||....||.|:.:|:..:...|..|..:
  Fly   180 FCGKRFSRPWLLQGHIR----THTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKA 240

  Fly   318 FVRRSHLTSHYRS---KGHAHTSSAQAALDN-----PVELDVKASNG----MQTGAKDEALLGKS 370
            |..:|:|..|..|   |.......:.||..|     |.....:.::|    :..|:...|:...|
  Fly   241 FALKSYLYKHEESSCMKNRGGVPGSGAASGNRPPSSPKRQQAEVTSGTISALAPGSPAAAVCAAS 305

  Fly   371 GS 372
            .|
  Fly   306 DS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
C2H2 Zn finger 226..243 CDD:275368 2/16 (13%)
C2H2 Zn finger 254..275 CDD:275368 5/23 (22%)
zf-C2H2 281..303 CDD:278523 9/21 (43%)
C2H2 Zn finger 283..303 CDD:275368 8/19 (42%)
zf-H2C2_2 296..320 CDD:290200 7/23 (30%)
C2H2 Zn finger 311..329 CDD:275368 6/17 (35%)
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 7/21 (33%)
C2H2 Zn finger 121..141 CDD:275368 6/19 (32%)
zf-C2H2 176..198 CDD:278523 5/25 (20%)
C2H2 Zn finger 178..198 CDD:275368 5/23 (22%)
zf-H2C2_2 191..214 CDD:290200 10/26 (38%)
zf-C2H2 204..226 CDD:278523 9/21 (43%)
C2H2 Zn finger 206..226 CDD:275368 8/19 (42%)
zf-H2C2_2 218..242 CDD:290200 6/23 (26%)
C2H2 Zn finger 234..250 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.