DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and Cf2

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001350854.1 Gene:Cf2 / 33692 FlyBaseID:FBgn0000286 Length:537 Species:Drosophila melanogaster


Alignment Length:359 Identity:81/359 - (22%)
Similarity:137/359 - (38%) Gaps:88/359 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PNR-NCRTCGLFIFCSTPSNLFEEPNSVMLHQIEVLTGLFLLGGPGNELPPFICSPCELDLQTAI 65
            ||. .|..||  ..|:| :.|.......|..|...:|       |.::||..  :|.::.|....
  Fly   172 PNEYKCTQCG--SICTT-AMLAAGQQGFMEQQEAAVT-------PDDQLPAM--APRDMRLTPEE 224

  Fly    66 AFRERVIRTQKTLQESPNLGNAELIESFAVGVEKEIQYAEEVTEIEVIDLLPEEHLLEETEEPYE 130
            ...::.::.:...|:                     |:.::..:.:     .::.|||:.:.  |
  Fly   225 QHHQQQLQAEHHHQQ---------------------QHQQQQQQQQ-----QQQELLEQQQR--E 261

  Fly   131 ICEQNEQPQVKVPAQEKKL---RRSTKTTPTVFTSVKFADNSQATRTQWSRLTEDEVVALKRE-- 190
            :.||.:|.||....|::.|   :.:.|..|   .:||...|:..     ..:.....|.:|.|  
  Fly   262 MQEQAQQQQVHHHQQDQDLAGDQVALKVPP---LTVKLNKNANG-----GAIVSHPQVIIKEEPL 318

  Fly   191 --RRKRDCI------CEQCGRHFTCPSNFKL------------HLLRHTGVKSFACDQCSQQFYT 235
              ....|.:      ..|.......|::..:            |.:||      .|..|.:.|.|
  Fly   319 SLSDSGDVVNSVPVYAIQANPGVPAPASSGVLVGTQTVPADLAHKIRH------KCPDCPKTFKT 377

  Fly   236 ATLLRRHQELHAGNA-------LFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMS 293
            ...|..|:::|.|.|       .:.|.||..:::.::...||.|: ||..|||.|..|.|||::.
  Fly   378 PGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRI-HTGEKPFHCGYCEKSFSVK 441

  Fly   294 GKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSH 327
            ..|..|:.:|||.:.:.|..|...|.:||.||.|
  Fly   442 DYLTKHIRTHTGEKPYTCPYCDKRFTQRSALTVH 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 14/73 (19%)
C2H2 Zn finger 198..218 CDD:275368 3/31 (10%)
C2H2 Zn finger 226..243 CDD:275368 5/16 (31%)
C2H2 Zn finger 254..275 CDD:275368 6/20 (30%)
zf-C2H2 281..303 CDD:278523 8/21 (38%)
C2H2 Zn finger 283..303 CDD:275368 7/19 (37%)
zf-H2C2_2 296..320 CDD:290200 8/23 (35%)
C2H2 Zn finger 311..329 CDD:275368 8/17 (47%)
Cf2NP_001350854.1 COG5048 <366..>473 CDD:227381 36/113 (32%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
C2H2 Zn finger 403..423 CDD:275368 6/20 (30%)
C2H2 Zn finger 431..451 CDD:275368 7/19 (37%)
zf-H2C2_2 443..468 CDD:316026 8/24 (33%)
C2H2 Zn finger 459..480 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.