DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and CG10959

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:382 Identity:82/382 - (21%)
Similarity:150/382 - (39%) Gaps:79/382 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EVLTGLFLLGGPGNELPPFICSPCELDLQTAIAFRERVIRTQKTLQESPNLGNAELIESFAVGVE 98
            :.:|||..|.....|.......|..:|     :|::..:..:..|.|..: ...||      |:|
  Fly    71 KTVTGLGRLAREEQEFQGVSAEPLAVD-----SFKKEYLPNEDVLSEEED-AEQEL------GLE 123

  Fly    99 KE--------IQYAEEVTEIEVIDLL--PE--------------EHLL-EETEEPYEICEQNEQP 138
            ::        :...::..:.|.||.:  |:              |.|| .|..:.|:..|..|:.
  Fly   124 QDEGNPLRIMVLGGKQSVDEETIDTMWQPDHDSSSASVNEGCALEALLGVENPQDYQPDEDGEEH 188

  Fly   139 QVKVPAQEKKLRRSTKTTPTVFTSVKFADN--------SQATRTQWSRLTEDEVVALKRERRKR- 194
            |.....|.:....:.......:|:.|:.:.        .||.:....:.|.|...||.:.|||. 
  Fly   189 QSVFKKQRQPKDYNCPHCDRRYTTQKYLNTHLKMSHPFPQAFKCVDCKATFDVDRALAQHRRKEH 253

  Fly   195 -DCICEQCGRHFTCPSNFKLHLLRHTGVKSFAC--DQCSQQF---YTATLLRR------------ 241
             :..|:.|.:.|....:...|:..|:|.::|.|  :.|.:.|   :..|..||            
  Fly   254 TEFACQLCDKVFKSSRSLLRHVQGHSGARTFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCEL 318

  Fly   242 -------------HQELHAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMS 293
                         |:..|.|...|||:.|...:::.|...:|:.| |:..||:.|.:|:.:|:..
  Fly   319 CGYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEHQAM-HSTEKPYKCDKCDSAFSRP 382

  Fly   294 GKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRS-KGHAHTSSAQAALDNPVEL 349
            ..|..|...|.|::.|.|..|..::.:.:.|::|.|: |..|..::.:.|...|:|:
  Fly   383 KALYHHKHLHLGIKKFKCKICGNAYAQAAGLSAHMRAHKLQASVNATEGAEAEPIEM 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 9/45 (20%)
C2H2 Zn finger 198..218 CDD:275368 4/19 (21%)
C2H2 Zn finger 226..243 CDD:275368 6/46 (13%)
C2H2 Zn finger 254..275 CDD:275368 5/20 (25%)
zf-C2H2 281..303 CDD:278523 5/21 (24%)
C2H2 Zn finger 283..303 CDD:275368 5/19 (26%)
zf-H2C2_2 296..320 CDD:290200 7/23 (30%)
C2H2 Zn finger 311..329 CDD:275368 4/17 (24%)
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 7/20 (35%)
COG5048 <258..416 CDD:227381 37/158 (23%)
C2H2 Zn finger 258..278 CDD:275368 4/19 (21%)
C2H2 Zn finger 289..308 CDD:275368 5/18 (28%)
C2H2 Zn finger 316..336 CDD:275368 1/19 (5%)
zf-H2C2_2 328..353 CDD:290200 7/24 (29%)
C2H2 Zn finger 344..364 CDD:275368 5/20 (25%)
zf-H2C2_2 357..381 CDD:290200 8/24 (33%)
C2H2 Zn finger 372..392 CDD:275368 5/19 (26%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.