DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and klf-3

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001022205.1 Gene:klf-3 / 191713 WormBaseID:WBGene00003480 Length:315 Species:Caenorhabditis elegans


Alignment Length:298 Identity:71/298 - (23%)
Similarity:100/298 - (33%) Gaps:119/298 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PPFICSPCELDLQTAIAFRERVIRTQKTLQESPNLGNAELIESFAVGVEKEIQYAEEVTEIEVID 114
            |..||:|  .|:.|             |...:|                   .|..|||.:..:.
 Worm   114 PHIICNP--YDVPT-------------TSDRNP-------------------PYYTEVTTVSAVT 144

  Fly   115 L---LPEEHLLEETEEPYEICEQ------NEQPQVKV-----PAQEKKLRRSTKTTPTVFTSVKF 165
            |   .|..|   :.|.|....|.      ::.|.:|:     |........||:::|:..||   
 Worm   145 LHSMTPPTH---KIETPPSSPENSFGPLASQLPAIKMEIPMHPLPHNGELDSTRSSPSSTTS--- 203

  Fly   166 ADNSQATRTQWSRLTEDEVVALKRERRKRDCICEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCS 230
            ::.|...|.  ||:          |..||:            |::           |.|.     
 Worm   204 SERSPLQRK--SRI----------ESNKRN------------PTD-----------KKFV----- 228

  Fly   231 QQFYTATLLRRHQELHAGNALFQCRY--CEATYSNASGRIQHERMRHTNVKPFTCK--ECNKSFA 291
                          :||      |.|  |...||.:|....||| .|:..|||.||  .|:..||
 Worm   229 --------------VHA------CTYPGCFKKYSKSSHLKAHER-THSGEKPFVCKWQNCSWKFA 272

  Fly   292 MSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYR 329
            .|.:|..||..|||.:.|.|..|..:|.|..||:.|.:
 Worm   273 RSDELTRHMRKHTGDKPFRCSLCDRNFARSDHLSLHMK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871 7/29 (24%)
C2H2 Zn finger 198..218 CDD:275368 1/19 (5%)
C2H2 Zn finger 226..243 CDD:275368 0/16 (0%)
C2H2 Zn finger 254..275 CDD:275368 9/22 (41%)
zf-C2H2 281..303 CDD:278523 10/23 (43%)
C2H2 Zn finger 283..303 CDD:275368 9/21 (43%)
zf-H2C2_2 296..320 CDD:290200 10/23 (43%)
C2H2 Zn finger 311..329 CDD:275368 7/17 (41%)
klf-3NP_001022205.1 C2H2 Zn finger 235..254 CDD:275368 7/19 (37%)
C2H2 Zn finger 262..284 CDD:275368 9/21 (43%)
zf-H2C2_2 276..301 CDD:290200 10/24 (42%)
C2H2 Zn finger 292..312 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.