| Sequence 1: | NP_651878.1 | Gene: | CG1792 / 43727 | FlyBaseID: | FBgn0039860 | Length: | 372 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001023313.1 | Gene: | M03D4.4 / 177375 | WormBaseID: | WBGene00019751 | Length: | 505 | Species: | Caenorhabditis elegans |
| Alignment Length: | 246 | Identity: | 59/246 - (23%) |
|---|---|---|---|
| Similarity: | 105/246 - (42%) | Gaps: | 29/246 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 120 HLLEETE----EPYEICEQNEQPQVKVPAQEKKLRRSTKTTPTVFTSVKFADNSQATRTQWSRLT 180
Fly 181 EDEVVALKR----ERRKRDCICEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRR 241
Fly 242 HQELHAGNALFQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGV 306
Fly 307 RAFHCDSCQVSFVRRSHLTSHY-RSKGHAH-------TSSAQAALDNPVEL 349 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1792 | NP_651878.1 | zf-AD | 6..80 | CDD:214871 | |
| C2H2 Zn finger | 198..218 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 226..243 | CDD:275368 | 7/16 (44%) | ||
| C2H2 Zn finger | 254..275 | CDD:275368 | 4/20 (20%) | ||
| zf-C2H2 | 281..303 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 283..303 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 296..320 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 311..329 | CDD:275368 | 6/18 (33%) | ||
| M03D4.4 | NP_001023313.1 | C2H2 Zn finger | 90..110 | CDD:275368 | 5/19 (26%) |
| zf-H2C2_2 | 102..127 | CDD:290200 | 7/24 (29%) | ||
| C2H2 Zn finger | 118..138 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 146..166 | CDD:275368 | 4/20 (20%) | ||
| zf-H2C2_2 | 158..181 | CDD:290200 | 6/22 (27%) | ||
| zf-C2H2 | 172..194 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 174..194 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||