DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and ZNF784

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_976308.1 Gene:ZNF784 / 147808 HGNCID:33111 Length:323 Species:Homo sapiens


Alignment Length:202 Identity:55/202 - (27%)
Similarity:75/202 - (37%) Gaps:43/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 CEQCGRHFTCPSNFKLHLLRHTGVKSFACDQCSQQFYTATLLRRHQELH---------------- 246
            |..||.....|::.:.|...|||.:.:.|..|.:.|.....|.|||..|                
Human   103 CHVCGHSCPGPASLRAHYSLHTGERPYRCALCPRAFKALAPLLRHQHRHGVEPGTSRRPPDTAAV 167

  Fly   247 --------------------AGNAL---FQCRYCEATYSNASGRIQHERMRHTNVKPFTCKECNK 288
                                ||.|:   |.||:|...:..:|....|||: ||..:|:.|..|.|
Human   168 AEQRPGVAPERAEVVMAAAAAGAAVGKPFACRFCAKPFRRSSDMRDHERV-HTGERPYHCGICGK 231

  Fly   289 SFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSSAQAALDNPVELDVKA 353
            .|..|..|..|...|||.|.|.|..|..:|...|:...|.|:  |.| .......|:..:|...|
Human   232 GFTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKHQRT--HFH-GPGPGLGDSGGQLGSSA 293

  Fly   354 SNGMQTG 360
            :.|..:|
Human   294 AEGSGSG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
C2H2 Zn finger 226..243 CDD:275368 5/16 (31%)
C2H2 Zn finger 254..275 CDD:275368 7/20 (35%)
zf-C2H2 281..303 CDD:278523 7/21 (33%)
C2H2 Zn finger 283..303 CDD:275368 7/19 (37%)
zf-H2C2_2 296..320 CDD:290200 10/23 (43%)
C2H2 Zn finger 311..329 CDD:275368 5/17 (29%)
ZNF784NP_976308.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
C2H2 Zn finger 67..87 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 5/19 (26%)
C2H2 Zn finger 131..151 CDD:275368 7/19 (37%)
COG5048 <194..276 CDD:227381 30/84 (36%)
C2H2 Zn finger 198..218 CDD:275368 7/20 (35%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
C2H2 Zn finger 254..274 CDD:275368 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..323 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4797
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.