Sequence 1: | NP_651878.1 | Gene: | CG1792 / 43727 | FlyBaseID: | FBgn0039860 | Length: | 372 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001373594.1 | Gene: | si:dkeyp-2e4.7 / 108191950 | ZFINID: | ZDB-GENE-061009-51 | Length: | 234 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 56/199 - (28%) |
---|---|---|---|
Similarity: | 82/199 - (41%) | Gaps: | 29/199 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 147 KKLRRSTKTTPTVFTSVKFADNSQATRTQWSRLTEDEV-----------VALKRERRKRDCICEQ 200
Fly 201 CGRHFTCPSNFKLHLLRHTGV-----KSFACDQCSQQFYTATLLRRHQELHAGNALFQCRYCEAT 260
Fly 261 YSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLT 325
Fly 326 SHYR 329 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1792 | NP_651878.1 | zf-AD | 6..80 | CDD:214871 | |
C2H2 Zn finger | 198..218 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 226..243 | CDD:275368 | 6/16 (38%) | ||
C2H2 Zn finger | 254..275 | CDD:275368 | 8/20 (40%) | ||
zf-C2H2 | 281..303 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 283..303 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 296..320 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 311..329 | CDD:275368 | 4/17 (24%) | ||
si:dkeyp-2e4.7 | NP_001373594.1 | C2H2 Zn finger | 91..111 | CDD:275368 | 7/19 (37%) |
C2H2 Zn finger | 124..144 | CDD:275368 | 7/19 (37%) | ||
SFP1 | <146..226 | CDD:227516 | 26/80 (33%) | ||
C2H2 Zn finger | 152..172 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 180..200 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 193..215 | CDD:404364 | 9/21 (43%) | ||
C2H2 Zn finger | 208..226 | CDD:275368 | 4/17 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |