DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1792 and si:dkeyp-2e4.7

DIOPT Version :9

Sequence 1:NP_651878.1 Gene:CG1792 / 43727 FlyBaseID:FBgn0039860 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001373594.1 Gene:si:dkeyp-2e4.7 / 108191950 ZFINID:ZDB-GENE-061009-51 Length:234 Species:Danio rerio


Alignment Length:199 Identity:56/199 - (28%)
Similarity:82/199 - (41%) Gaps:29/199 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 KKLRRSTKTTPTVFTSVKFADNSQATRTQWSRLTEDEV-----------VALKRERRKRDCICEQ 200
            ::|:...||..|       :|.|.:...     ||||:           ..::....:...:||.
Zfish    41 RRLKYRVKTDET-------SDQSSSDTD-----TEDELPISTSPTPGEDFIMRIHTGEAPYVCEL 93

  Fly   201 CGRHFTCPSNFKLHLLRHTGV-----KSFACDQCSQQFYTATLLRRHQELHAGNALFQCRYCEAT 260
            ||:.|......|.|...||||     |..:||||..:|..:::|:.|...|.|...|.|..|:.|
Zfish    94 CGKAFKRKHWLKEHFYIHTGVKRKRKKRLSCDQCEMKFECSSVLQGHLNKHRGERPFACVQCDKT 158

  Fly   261 YSNASGRIQHERMRHTNVKPFTCKECNKSFAMSGKLRTHMLSHTGVRAFHCDSCQVSFVRRSHLT 325
            |.|.....||.|..|:. |...|..|...|:....|:.||..|||.|.:.|..|:.:|..:....
Zfish   159 YFNQHDLNQHLRDCHSE-KKHGCYLCGNEFSRRSLLQKHMRIHTGERPYSCPHCEKTFPYKYSFE 222

  Fly   326 SHYR 329
            .|.:
Zfish   223 MHVK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1792NP_651878.1 zf-AD 6..80 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)
C2H2 Zn finger 226..243 CDD:275368 6/16 (38%)
C2H2 Zn finger 254..275 CDD:275368 8/20 (40%)
zf-C2H2 281..303 CDD:278523 6/21 (29%)
C2H2 Zn finger 283..303 CDD:275368 6/19 (32%)
zf-H2C2_2 296..320 CDD:290200 10/23 (43%)
C2H2 Zn finger 311..329 CDD:275368 4/17 (24%)
si:dkeyp-2e4.7NP_001373594.1 C2H2 Zn finger 91..111 CDD:275368 7/19 (37%)
C2H2 Zn finger 124..144 CDD:275368 7/19 (37%)
SFP1 <146..226 CDD:227516 26/80 (33%)
C2H2 Zn finger 152..172 CDD:275368 8/19 (42%)
C2H2 Zn finger 180..200 CDD:275368 6/19 (32%)
zf-H2C2_2 193..215 CDD:404364 9/21 (43%)
C2H2 Zn finger 208..226 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.