Sequence 1: | NP_651878.1 | Gene: | CG1792 / 43727 | FlyBaseID: | FBgn0039860 | Length: | 372 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005171194.1 | Gene: | bcl6ab / 100001936 | ZFINID: | ZDB-GENE-030131-7523 | Length: | 566 | Species: | Danio rerio |
Alignment Length: | 300 | Identity: | 69/300 - (23%) |
---|---|---|---|
Similarity: | 107/300 - (35%) | Gaps: | 90/300 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 LLEETEEPYEICEQN--EQP-----QVKVPAQEKKLRRSTKTTPTVFTSVKF------------- 165
Fly 166 ADNSQAT---------------RTQWSRLTEDEVVALKRE----------------------RRK 193
Fly 194 RDCICEQC------------GRHFTCP----------SNFKLHLLRHTGVKSFACDQCSQQFYTA 236
Fly 237 TLLRRHQELHAGNALFQCRYCEATYSNASGRIQHER---MRHTNVKPFTCKECNKSFAMSGKLRT 298
Fly 299 HMLSHTGVRAFHCDSCQVSFVRRSHLTSHYRSKGHAHTSS 338 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1792 | NP_651878.1 | zf-AD | 6..80 | CDD:214871 | |
C2H2 Zn finger | 198..218 | CDD:275368 | 5/41 (12%) | ||
C2H2 Zn finger | 226..243 | CDD:275368 | 5/16 (31%) | ||
C2H2 Zn finger | 254..275 | CDD:275368 | 4/23 (17%) | ||
zf-C2H2 | 281..303 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 283..303 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 296..320 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 311..329 | CDD:275368 | 6/17 (35%) | ||
bcl6ab | XP_005171194.1 | BTB | 22..126 | CDD:279045 | |
BTB | 33..128 | CDD:197585 | |||
C2H2 Zn finger | 412..433 | CDD:275368 | 2/20 (10%) | ||
zf-H2C2_2 | 426..450 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 441..461 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 453..478 | CDD:290200 | 6/28 (21%) | ||
C2H2 Zn finger | 469..489 | CDD:275368 | 4/23 (17%) | ||
zf-H2C2_2 | 481..506 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 497..517 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 510..534 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 525..543 | CDD:275368 | 6/17 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |