DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11539 and AT2G04845

DIOPT Version :9

Sequence 1:NP_001263148.1 Gene:CG11539 / 43726 FlyBaseID:FBgn0039859 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_565315.1 Gene:AT2G04845 / 815030 AraportID:AT2G04845 Length:218 Species:Arabidopsis thaliana


Alignment Length:196 Identity:90/196 - (45%)
Similarity:122/196 - (62%) Gaps:14/196 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TKIL--GHRVILVPYEARHVPKYHEWMSNETLRELTASEELTLEEEHEMQRSWREDSDKLTFIVL 69
            ||:.  |.||:||||.|.||||||:||.:..|.|.|.||.|:||:|:|||.||.:|.:|.|||||
plant     7 TKVSLEGKRVVLVPYMAEHVPKYHQWMQDSALLEATGSEPLSLEQEYEMQLSWTQDPNKRTFIVL 71

  Fly    70 DAETYSRD----QDEIAAMVGDTNLFLHQDPDSQIPTAEAEIMIAEPYARGKGFGREAMLLMLKY 130
            |.:....|    |..:.||.||.|::::...|.::  ||.|||||||.:||||.|:|::|:|:.|
plant    72 DKDFVKGDLAHGQPHVEAMTGDVNIYMNDVDDPKV--AEVEIMIAEPRSRGKGLGKESVLIMMAY 134

  Fly   131 AQSQPQLKLDKFEVKIDMDNAASLHLFKSFMFVETRRVEIFHEVTLERPIT----PDWINWLDQQ 191
            ...  .|::.||..||...|.|||.||:...|.|:....||.|||||.|:|    .:.:..||:.
plant   135 GVK--NLEIHKFTAKIGESNTASLSLFRKLGFEESSYSGIFKEVTLEYPVTNLRREELLKLLDEV 197

  Fly   192 V 192
            :
plant   198 I 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11539NP_001263148.1 Acetyltransf_3 13..158 CDD:290041 73/148 (49%)
Acetyltransf_1 76..160 CDD:278980 37/87 (43%)
AT2G04845NP_565315.1 Acetyltransf_3 15..165 CDD:290041 74/153 (48%)
Acetyltransf_1 96..165 CDD:278980 30/72 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 142 1.000 Domainoid score I1518
eggNOG 1 0.900 - - E1_KOG4135
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9231
Inparanoid 1 1.050 161 1.000 Inparanoid score I1629
OMA 1 1.010 - - QHG55166
OrthoDB 1 1.010 - - D1507385at2759
OrthoFinder 1 1.000 - - FOG0005766
OrthoInspector 1 1.000 - - oto3058
orthoMCL 1 0.900 - - OOG6_103573
Panther 1 1.100 - - LDO PTHR13256
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.