DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11539 and Nat9

DIOPT Version :9

Sequence 1:NP_001263148.1 Gene:CG11539 / 43726 FlyBaseID:FBgn0039859 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001349818.1 Gene:Nat9 / 66176 MGIID:1913426 Length:241 Species:Mus musculus


Alignment Length:195 Identity:94/195 - (48%)
Similarity:126/195 - (64%) Gaps:10/195 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHLNENTKILGHRVILVPYEARHVPKYHEWMSNETLRELTASEELTLEEEHEMQRSWREDSDKLT 65
            |.||:||.::|.:|:||||.:.|||:|||||.:|.||.|||||:|||::|:|||.||.||.||.|
Mouse     1 MKLNQNTMLVGKKVVLVPYTSEHVPRYHEWMKSEELRHLTASEQLTLQQEYEMQCSWCEDEDKCT 65

  Fly    66 FIVLDAETYS---RDQDEIAAMVGDTNLFLHQDPDSQIPT-AEAEIMIAEPYARGKGFGREAMLL 126
            |||||||.:.   |..:| :.||||.||||   .|.:.|| .|.|:|||||..|.:|.|.||.||
Mouse    66 FIVLDAEKWQAQPRPPEE-SCMVGDVNLFL---TDLEDPTLGEIEVMIAEPSYRRQGLGTEASLL 126

  Fly   127 MLKYAQSQPQLKLDKFEVKIDMDNAASLHLFKSFMFVETRRVEIFHEVTLERPITPDWINWLDQQ 191
            ::.|..:  :|.|.|||.||..:|..|:.:|:...|.:.....:|.||||...::.....|:.:|
Mouse   127 IMSYGVT--KLGLTKFEAKIGQENEPSIRMFQKLHFKQVAMSNVFQEVTLRLAVSEPERKWILEQ 189

  Fly   192  191
            Mouse   190  189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11539NP_001263148.1 Acetyltransf_3 13..158 CDD:290041 79/148 (53%)
Acetyltransf_1 76..160 CDD:278980 38/84 (45%)
Nat9NP_001349818.1 Acetyltransf_3 14..161 CDD:315878 80/152 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833731
Domainoid 1 1.000 143 1.000 Domainoid score I4649
eggNOG 1 0.900 - - E1_KOG4135
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9231
Inparanoid 1 1.050 171 1.000 Inparanoid score I4110
Isobase 1 0.950 - 0 Normalized mean entropy S4366
OMA 1 1.010 - - QHG55166
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005766
OrthoInspector 1 1.000 - - oto92368
orthoMCL 1 0.900 - - OOG6_103573
Panther 1 1.100 - - LDO PTHR13256
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R795
SonicParanoid 1 1.000 - - X4155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.