DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11539 and nat9

DIOPT Version :9

Sequence 1:NP_001263148.1 Gene:CG11539 / 43726 FlyBaseID:FBgn0039859 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_002939608.1 Gene:nat9 / 100495076 XenbaseID:XB-GENE-968973 Length:207 Species:Xenopus tropicalis


Alignment Length:199 Identity:98/199 - (49%)
Similarity:128/199 - (64%) Gaps:4/199 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHLNENTKILGHRVILVPYEARHVPKYHEWMSNETLRELTASEELTLEEEHEMQRSWREDSDKLT 65
            |.:||||.:.|.||:|||||..|||:|||||.:|.|::|||||.||||:|:.||:|||||:||.|
 Frog     1 MRVNENTVLRGQRVLLVPYEPHHVPRYHEWMKSEELQKLTASEPLTLEQEYGMQQSWREDADKCT 65

  Fly    66 FIVLDAETYSRDQDEIAAMVGDTNLFLHQDPDSQIPTAEAEIMIAEPYARGKGFGREAMLLMLKY 130
            ||:|||..:.:...|...||||.|||| .:||:| ..||.|:|||||..||:|.|.|::.|||.|
 Frog    66 FIILDAVLWDQGCPEHQCMVGDVNLFL-TEPDNQ-ALAETEVMIAEPSYRGRGLGEESVRLMLSY 128

  Fly   131 AQSQPQLKLDKFEVKIDMDNAASLHLFKSFMFVETRRVEIFHEVTLERPITPDWINWLDQQVDLR 195
            ..:  .|.:..||.||..:|.:|:.||....|.:....|:|.||||...:|....:||......:
 Frog   129 GIT--ALGITTFEAKIGQENLSSIRLFHKLHFQQASVSEVFQEVTLRWEVTEQERHWLLDSTLFQ 191

  Fly   196 MQCY 199
            |..|
 Frog   192 MAAY 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11539NP_001263148.1 Acetyltransf_3 13..158 CDD:290041 79/144 (55%)
Acetyltransf_1 76..160 CDD:278980 38/83 (46%)
nat9XP_002939608.1 Acetyltransf_3 13..159 CDD:379112 80/149 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 153 1.000 Domainoid score I4264
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9231
Inparanoid 1 1.050 183 1.000 Inparanoid score I3840
OMA 1 1.010 - - QHG55166
OrthoDB 1 1.010 - - D1507385at2759
OrthoFinder 1 1.000 - - FOG0005766
OrthoInspector 1 1.000 - - oto102677
Panther 1 1.100 - - LDO PTHR13256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.