DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CCNE2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_477097.1 Gene:CCNE2 / 9134 HGNCID:1590 Length:404 Species:Homo sapiens


Alignment Length:159 Identity:31/159 - (19%)
Similarity:67/159 - (42%) Gaps:27/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LKKLEDQLHALTSDELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMWYEL 289
            |||....:|    |:.:|.|  :..|:.:..::||                 .::|...:: |.|
Human   118 LKKESRYVH----DKHFEVL--HSDLEPQMRSILL-----------------DWLLEVCEV-YTL 158

  Fly   290 PSDVLFSAMSLVDRF-LDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDL 353
            ..:..:.|....||| |.:..:....:..:.:.|..:|.|..::.....::...::...|:..|:
Human   159 HRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDI 223

  Fly   354 ERMAGVIANKLGVQMGHAPITSVSYLRIY 382
            .||..:|...|..::  .|:|.:|:|.::
Human   224 LRMELIILKALKWEL--CPVTIISWLNLF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 15/78 (19%)
CCNE2NP_477097.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Cyclin_N 112..239 CDD:278560 27/146 (18%)
Cyclin_C 241..361 CDD:281044 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.