DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CCNB2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_004692.1 Gene:CCNB2 / 9133 HGNCID:1580 Length:398 Species:Homo sapiens


Alignment Length:323 Identity:65/323 - (20%)
Similarity:118/323 - (36%) Gaps:77/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 PTDWMRIADEGRYGTPGAAGLEYQKYEQQQQLEDLAESEAGAVGGASNNNGESSSSLKKLED--- 230
            |....::|.:|...||                ||::..|....      ...|.:.|.|:||   
Human    80 PVQMEKLAPKGPSPTP----------------EDVSMKEENLC------QAFSDALLCKIEDIDN 122

  Fly   231 ---QLHALTSD---ELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMW--- 286
               :...|.||   ::|:.|::.:|||            |.......|||.:..:...|..|   
Human   123 EDWENPQLCSDYVKDIYQYLRQLEVLQ------------SINPHFLDGRDINGRMRAILVDWLVQ 175

  Fly   287 ----YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCG 347
                :.|..:.|:..:.::||||....|..|.:..:.:.:..||.|..::.....||.|.|:...
Human   176 VHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA 240

  Fly   348 CTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELEN 412
            .|:..:..|..:|..:|..::|..       |.:::....:.|.|:..:.....:.|        
Human   241 YTSSQIREMETLILKELKFELGRP-------LPLHFLRRASKAGEVDVEQHTLAKYL-------- 290

  Fly   413 RLEILMCDVKTTVITPSTLALVLICLHL------DFHIKESYTRGSPELKHVFEYILFLQQYM 469
             :|:.:.|.......||.:|....||..      .:::|:.|..|..|     ..:|.:.|:|
Human   291 -MELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTE-----NEVLEVMQHM 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 18/77 (23%)
CCNB2NP_004692.1 Cyclin_N 137..262 CDD:278560 30/136 (22%)
Cyclin_C 264..382 CDD:281044 18/105 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.