DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CCNG2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_004345.1 Gene:CCNG2 / 901 HGNCID:1593 Length:344 Species:Homo sapiens


Alignment Length:344 Identity:99/344 - (28%)
Similarity:168/344 - (48%) Gaps:47/344 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 ELYETLKEYDVLQDKFH------TVLLLPKESRREVTAGGRDGSAYVLRCLKMWYELPSDVLFSA 297
            :|...|..|...:::|.      :::....|:...:..|.|:.....||.|..::...::....|
Human    16 QLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKVEDLRSLANFFGSCTETFVLA 80

  Fly   298 MSLVDRFLDRMAVKPKHMACMSVASFHLA--IKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVI 360
            ::::||||..|.|||||::|:.|.||.||  |.:.|.......|::.||||.|||.|::||..:|
Human    81 VNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIPSTHDVIRISQCKCTASDIKRMEKII 145

  Fly   361 ANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVKTTV 425
            :.||..::  ...|::::|.:|:.:......|        .::::.|::||.:|:...|.:..:.
Human   146 SEKLHYEL--EATTALNFLHLYHTIILCHTSE--------RKEILSLDKLEAQLKACNCRLIFSK 200

  Fly   426 ITPSTLALVLICLHLDFHIKESYTRGSPELKHVFEYILFLQQYMRIPDRVFTCGFSIVSGILSHY 490
            ..||.|||.|:.|.::       |..|.||   .|.:|.::::.:|.|..|.....:||..|:.|
Human   201 AKPSVLALCLLNLEVE-------TLKSVEL---LEILLLVKKHSKINDTEFFYWRELVSKCLAEY 255

  Fly   491 NGQNKA-PYKQRLVWKLSSRTLRVLRPINRFSS--DLPTIEEGIPNALDDGLRSRTESISSEE-- 550
            :..... |..::|||.:|.||.:.|.  |.:.|  :||||.||       |....:||..|.|  
Human   256 SSPECCKPDLKKLVWIVSRRTAQNLH--NSYYSVPELPTIPEG-------GCFDESESEDSCEDM 311

  Fly   551 ---EEDWPTSPIIPIFEQC 566
               ||...:||  |..::|
Human   312 SCGEESLSSSP--PSDQEC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 32/79 (41%)
CCNG2NP_004345.1 CYCLIN_CCNG2 55..150 CDD:410287 36/94 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..320 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9622
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4903
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003985
OrthoInspector 1 1.000 - - otm40801
orthoMCL 1 0.900 - - OOG6_110423
Panther 1 1.100 - - LDO PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2747
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.