DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CCNE1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001229.1 Gene:CCNE1 / 898 HGNCID:1589 Length:410 Species:Homo sapiens


Alignment Length:264 Identity:55/264 - (20%)
Similarity:106/264 - (40%) Gaps:61/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFL--D 306
            |:::.:||.|...:||                 .:::...:: |:|..:..:.|....||::  .
Human   134 LEQHPLLQPKMRAILL-----------------DWLMEVCEV-YKLHRETFYLAQDFFDRYMATQ 180

  Fly   307 RMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHA 371
            ...||.. :..:.::|..:|.|..::.|........::...|:..::..|..:|...|..::  :
Human   181 ENVVKTL-LQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRL--S 242

  Fly   372 PITSVSYLRIYYAL-FRNLAKEIGGDFFKFYQQ--LIKLEELENRLEILMCDVKTTVITPSTLAL 433
            |:|.||:|.:|..: :.|...|:   ....|.|  .|::.||   |::.:.||.           
Human   243 PLTIVSWLNVYMQVAYLNDLHEV---LLPQYPQQIFIQIAEL---LDLCVLDVD----------- 290

  Fly   434 VLICLHLDFHIKES---YTRGSPEL-KHVFEYILFLQQYMRIPDRV-FTCGFSIV-----SGILS 488
               ||...:.|..:   |...|.|| :.|..|     |:..|.:.| :...|::|     |..|.
Human   291 ---CLEFPYGILAASALYHFSSSELMQKVSGY-----QWCDIENCVKWMVPFAMVIRETGSSKLK 347

  Fly   489 HYNG 492
            |:.|
Human   348 HFRG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 14/79 (18%)
CCNE1NP_001229.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Cyclin_N 115..242 CDD:306612 21/128 (16%)
Cyclin_C 245..363 CDD:308564 33/132 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.