DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CCNB1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_114172.1 Gene:CCNB1 / 891 HGNCID:1579 Length:433 Species:Homo sapiens


Alignment Length:323 Identity:66/323 - (20%)
Similarity:123/323 - (38%) Gaps:61/323 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 TPGAAGLEYQKYEQQQQLEDLAESEAGAVGGASNNNGESSSSLKKLEDQLHALTSDELYETLKEY 247
            |.|.|..|          |||.::.:..:...::.:.|..:     :..|.:....::|..|::.
Human   132 TSGCAPAE----------EDLCQAFSDVILAVNDVDAEDGA-----DPNLCSEYVKDIYAYLRQL 181

  Fly   248 DVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKP 312
            :..|......||     .||||...|......|..::|.:.|..:.::..:|::|||:....|..
Human   182 EEEQAVRPKYLL-----GREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPK 241

  Fly   313 KHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVS 377
            |.:..:.|.:..:|.|..::.|....|...::....|...:.:|...|...|...:|. |: .:.
Human   242 KMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGR-PL-PLH 304

  Fly   378 YLRIYYALFRNLAKEIGGDFFKFYQQLIKLEE---LENRLEILMCDVKTTVITPSTLALVLICLH 439
            :||        .|.:||.         :.:|:   .:..:|:.|.|.......||.:|....||.
Human   305 FLR--------RASKIGE---------VDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLA 352

  Fly   440 LDFHIKESYTRGSPELKHVFEY----ILFLQQYMRIPDRVFTCGFSIV---SGILSHYNGQNK 495
            |.......:|   |.|:|...|    :|.:.|::         ..::|   .|:..|...:||
Human   353 LKILDNGEWT---PTLQHYLSYTEESLLPVMQHL---------AKNVVMVNQGLTKHMTVKNK 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 15/77 (19%)
CCNB1NP_114172.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..47
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..116
Interaction with CDK2 169..177 1/7 (14%)
Cyclin_N 173..298 CDD:278560 28/129 (22%)
Interaction with CDK2 258..261 0/2 (0%)
Cyclin_C 300..418 CDD:281044 28/134 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.