DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CCNA1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_003905.1 Gene:CCNA1 / 8900 HGNCID:1577 Length:465 Species:Homo sapiens


Alignment Length:287 Identity:69/287 - (24%)
Similarity:112/287 - (39%) Gaps:74/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 SSLKKLEDQLHALTSD---------ELYETLKEYDVL-QDKFHTVLLLPKESRREVTAGGRDGSA 277
            |||....:.:.:|.:|         |:|:.|:|.::. :.|.|.:...|     ::|.|.|    
Human   189 SSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQP-----DITEGMR---- 244

  Fly   278 YVLRCLKMW-------YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPI 335
               ..|..|       |:|.::.|:.|::.:||||..|:|....:..:..|:..||.|..::.|.
Human   245 ---TILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPP 306

  Fly   336 PAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITS---VSYLRIYYALFR--NLAKEIGG 395
            ..::.|.|:....|...|.:|..::...|...: ..|.|:   :.|||......|  ||||    
Human   307 EVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDL-TVPTTNQFLLQYLRRQGVCVRTENLAK---- 366

  Fly   396 DFFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLALVLICLHLDFHIKESYTRGS---PELKH 457
                 |...:.|.|.:..|:.|          ||.:|....||       .:||...   ||...
Human   367 -----YVAELSLLEADPFLKYL----------PSLIAAAAFCL-------ANYTVNKHFWPETLA 409

  Fly   458 VF------EYILFLQQ----YMRIPDR 474
            .|      |.:..|.:    |:.||.|
Human   410 AFTGYSLSEIVPCLSELHKAYLDIPHR 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 20/77 (26%)
CCNA1NP_003905.1 Cyclin_N2 71..>145 CDD:293109
Cyclin_N 214..340 CDD:278560 33/138 (24%)
Cyclin_C 342..459 CDD:281044 31/121 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.