DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CLN1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_013926.1 Gene:CLN1 / 855239 SGDID:S000004812 Length:546 Species:Saccharomyces cerevisiae


Alignment Length:362 Identity:67/362 - (18%)
Similarity:112/362 - (30%) Gaps:120/362 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 NNGESSSSLKKLEDQLH---ALTSDEL---YETLKEYDVLQDKFHTVLLLPKESRREVTA----- 270
            |:.|..:.|.....|.:   .|::.||   |||::||.  ::....||:...:::.::..     
Yeast     2 NHSEVKTGLIVTAKQTYYPIELSNAELLTHYETIQEYH--EEISQNVLVQSSKTKPDIKLIDQQP 64

  Fly   271 -----GGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQL 330
                 ..|:.....|..|.:...:.:.:.|.|:...||:..:..|.......:......||.|  
Yeast    65 EMNPHQTREAIVTFLYQLSVMTRVSNGIFFHAVRFYDRYCSKRVVLKDQAKLVVGTCLWLAAK-- 127

  Fly   331 DLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMG--------HAPITSVSYLRIYYALFR 387
                         :..||..         |.|.:.:..|        .|.|..:|.|..|..   
Yeast   128 -------------TWGGCNH---------IINNVSIPTGGRFYGPNPRARIPRLSELVHYCG--- 167

  Fly   388 NLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLALVLICLHLDFHIKESYTRGS 452
                  |.|.|. ....|::|  .:.|:.|..||...:|....|.:...||              
Yeast   168 ------GSDLFD-ESMFIQME--RHILDTLNWDVYEPMINDYILNVDENCL-------------- 209

  Fly   453 PELKHVFEYILFLQQYMRIPDRVFTCGFSIVSGILSHYNGQNKAPYKQRLVWKLSSRTLRVLRPI 517
                  .:|.|:..|                   |.:.|...|.       |....::.      
Yeast   210 ------IQYELYKNQ-------------------LQNNNSNGKE-------WSCKRKSQ------ 236

  Fly   518 NRFSSD--LPTIEEGIPNA-LDDGLRSRTESISSEEE 551
               |||  ..|:||.|.:: ...||...|.::..:||
Yeast   237 ---SSDDSDATVEEHISSSPQSTGLDGDTTTMDEDEE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 12/77 (16%)
CLN1NP_013926.1 COG5024 31..539 CDD:227357 60/333 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.