DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CLB6

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_011623.3 Gene:CLB6 / 853003 SGDID:S000003341 Length:380 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:53/266 - (19%)
Similarity:91/266 - (34%) Gaps:86/266 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 LEDQLHALTSDELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMWYELPSD 292
            |:..:.||..|.|.|       :.:|||                          ||       .:
Yeast   151 LKSSMRALLIDWLVE-------VHEKFH--------------------------CL-------PE 175

  Fly   293 VLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMA 357
            .||.|::|:||||.:..||...:..:.:....:|.|..::|.....:...::....|...:.:..
Yeast   176 TLFLAINLLDRFLSQNVVKLNKLQLLCITCLFIACKFEEVKLPKITNFAYVTDGAATVEGIRKAE 240

  Fly   358 GVIANKLGVQMGHAP-----ITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEIL 417
            ..:.:.||..:. .|     |..:|....|....||:||.|                    :|..
Yeast   241 LFVLSSLGYNIS-LPNPLNFIRRISKADNYCIETRNMAKFI--------------------MEYS 284

  Fly   418 MCDVKTTVITPSTLALVLICLHLDFHIKES----------YTRG-----SPELKHVFEYILFLQQ 467
            :|..|...:.||.||  .:.:::...||..          |:.|     .|..|   ::|..|.:
Yeast   285 ICCNKFIHLKPSYLA--AMSMYIARKIKNENSKWDETFIHYSGGIDIESDPAFK---DFISELVE 344

  Fly   468 YMRIPD 473
            .:.:||
Yeast   345 DIAVPD 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 14/77 (18%)
CLB6NP_011623.3 COG5024 1..380 CDD:227357 53/266 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.