DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CLB3

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_010126.1 Gene:CLB3 / 851400 SGDID:S000002314 Length:427 Species:Saccharomyces cerevisiae


Alignment Length:281 Identity:61/281 - (21%)
Similarity:99/281 - (35%) Gaps:85/281 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 EQQQQLEDLAESEAGAVGGASNNNGESSSSLKKLEDQ----LHALTSDEL---------YETLKE 246
            ||::.:||..|||.                 .:.|||    |....||.|         |.|  .
Yeast   106 EQEEPVEDDGESEE-----------------DEEEDQEPLLLQHYASDTLVWEHAFRTYYRT--T 151

  Fly   247 YDVLQDKFHTVLLLPK------ESRREVTAGGRDGSAYV-----LR-----CLKMW-------YE 288
            .|...|..:.|:::.:      |..|::....:....|:     ||     .|..|       ::
Yeast   152 LDPNDDDVYDVVMVAELSNEIFEYMRKLEDLYKPNPYYMDKQPELRWSFRSTLIDWIVQVHEKFQ 216

  Fly   289 LPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDL 353
            |..:.|:..::::||:|.:..|.......:..||..:|.|..::.....:|.|.:|:...:..||
Yeast   217 LLPETLYLCINIIDRYLCKEVVPVNKFQLVGAASLFIAAKYEEINCPTIKDFVYMSENCYSRNDL 281

  Fly   354 ERMAGVIANKLGVQMG-HAPITSVSYLR------IYYALFRNLAKEIGGDFFKFYQQLIKLEELE 411
            ......|.|.|..::| ..|   :|:||      .|....|.|||.:                  
Yeast   282 LDAERTILNGLEFELGWPGP---MSFLRRISKADDYEHDTRTLAKYL------------------ 325

  Fly   412 NRLEILMCDVKTTVITPSTLA 432
              ||..:.|.:.....||.||
Yeast   326 --LESTIMDHRLVSAQPSWLA 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 17/77 (22%)
CLB3NP_010126.1 COG5024 4..421 CDD:227357 61/281 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.