DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CLB4

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_013311.1 Gene:CLB4 / 850907 SGDID:S000004200 Length:460 Species:Saccharomyces cerevisiae


Alignment Length:339 Identity:66/339 - (19%)
Similarity:121/339 - (35%) Gaps:100/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 EQQQQL--ED----LAESEAGAVGGASNNNGESSSSL--KKLEDQLHALTSDELYETLK------ 245
            |||:.:  ||    |.:|..|:.......|.::...|  :::.||  .:.:||:||...      
Yeast    93 EQQRDVRHEDSDYFLIDSSEGSSTDDEQVNEDAIDDLLSRRVNDQ--QIQADEVYEDFDGEMQDV 155

  Fly   246 -EYDV---------------------------------LQDKFHTVLLLPKESR------REVTA 270
             |.||                                 |.|..|.|:::.:.:.      ||:..
Yeast   156 IEEDVDSQIEPLSPINNDEIQTELDRAFEKYFRSVPNPLDDDTHDVVMVVEYASDIFYYLRELEV 220

  Fly   271 GGRDGSAYVLRCLKM----------W-------YELPSDVLFSAMSLVDRFLDRMAVKPKHMACM 318
            ..|....|:...:::          |       ::|..:.|:..:::|||||.:..|.......:
Yeast   221 KYRPNPYYMQNQVELTWPFRRTMIDWLVQLHFRFQLLPETLYLTINIVDRFLSKKTVTLNRFQLV 285

  Fly   319 SVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMG-HAPITSVSYLRIY 382
            .|::..:|.|..::.....:|||.:.:...|..|:.|....:.:.|..::| ..|:         
Yeast   286 GVSALFIAAKFEEINCPTLDDLVYMLENTYTRDDIIRAEQYMIDTLEFEIGWPGPM--------- 341

  Fly   383 YALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLALVLICLHLDFHIKES 447
             ...|.::|   .|.:.|..:.:....||           ||::.|..:|.....|....:....
Yeast   342 -PFLRRISK---ADDYDFEPRTLAKYLLE-----------TTIVEPKLVAAAPSWLAAGAYFLSR 391

  Fly   448 YTRGSPE--LKHVF 459
            ...||.:  |||||
Yeast   392 TILGSNDWSLKHVF 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 17/77 (22%)
CLB4NP_013311.1 COG5024 10..459 CDD:227357 66/339 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.