DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCA1;2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_177863.2 Gene:CYCA1;2 / 844075 AraportID:AT1G77390 Length:442 Species:Arabidopsis thaliana


Alignment Length:422 Identity:82/422 - (19%)
Similarity:146/422 - (34%) Gaps:114/422 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 ANGINRNAEMP-----TDW-MRIADEGRYGTPGAAGLEYQKYEQQQQLED----LAESEAGAVGG 213
            :|.|.::.:.|     .:| :.|.|.|....|.|.......||..:.|:.    |..|.|.::..
plant    59 SNKIGQSKKAPKPALSRNWNLGILDSGLPPKPNAKSNIIVPYEDTELLQSDDSLLCSSPALSLDA 123

  Fly   214 ASNNNGESSSSLKKL--------------------EDQLHALTSD------------ELYETLKE 246
            :...:..|.|:...|                    :|::..:.||            ::||.|:.
plant   124 SPTQSDPSISTHDSLTNHVVDYMVESTTDDGNDDDDDEIVNIDSDLMDPQLCASFACDIYEHLRV 188

  Fly   247 YDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMW-------YELPSDVLFSAMSLVDRF 304
            .:|.:   ...|...:.::..:.|..|.       .|..|       |.|..:.|:.|::.|||:
plant   189 SEVNK---RPALDYMERTQSSINASMRS-------ILIDWLVEVAEEYRLSPETLYLAVNYVDRY 243

  Fly   305 LDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMG 369
            |...|:..:::..:.|....:|.|..::.....||...|:.......:|..|...:.|.|..:: 
plant   244 LTGNAINKQNLQLLGVTCMMIAAKYEEVCVPQVEDFCYITDNTYLRNELLEMESSVLNYLKFEL- 307

  Fly   370 HAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLALV 434
             ...|:..:||.:                        |...:.|.|:           ||.|:..
plant   308 -TTPTAKCFLRRF------------------------LRAAQGRKEV-----------PSLLSEC 336

  Fly   435 LICLHLDFHIKE-SYTRGSPELKHVFEYILFLQQYMRIPDRVFTCGFSIVSGILSHYNGQNKAPY 498
            |.|...:..:.: :..|.:|.|  |....:||.||...|.|      ...:..|.||... :|.:
plant   337 LACYLTELSLLDYAMLRYAPSL--VAASAVFLAQYTLHPSR------KPWNATLEHYTSY-RAKH 392

  Fly   499 KQRLVWKLSSRTLRVLRPIN-RFSSDLPTIEE 529
            .:..|..|       |:..| :.|||:..|.:
plant   393 MEACVKNL-------LQLCNEKLSSDVVAIRK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 18/77 (23%)
CYCA1;2NP_177863.2 CYCLIN_AtCycA_like_rpt1 171..306 CDD:410265 28/144 (19%)
CYCLIN_AtCycA-like_rpt2 310..424 CDD:410210 33/159 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.