DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCB2;4

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001323249.1 Gene:CYCB2;4 / 843964 AraportID:AT1G76310 Length:459 Species:Arabidopsis thaliana


Alignment Length:225 Identity:50/225 - (22%)
Similarity:92/225 - (40%) Gaps:32/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 YELPSDVLFSAMSLVDRFLD-RMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTA 350
            :||..:.|:..::|:||||. ...:..|.:..:.|.:..||.|..::.....:||:.||....|.
plant   224 FELMEETLYLTINLIDRFLAVHQHIARKKLQLVGVTAMLLACKYEEVSVPVVDDLILISDKAYTR 288

  Fly   351 GDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRN--LAKEIGGDF-----FKFYQQLIKLE 408
            .::..|.... .|......|.  .|..|:..:|.:.:.  :|..:..:|     :.|.::.:|..
plant   289 TEILDMVKSF-TKSCPDYNHG--CSALYVDDHYCVLQEKLMANTLQFNFCLPTPYVFMRRFLKAA 350

  Fly   409 ELENRLEIL------MCDVKTTVI--TPSTLALVLICLHLDFHIKESYTRGSPELKHVFEYILFL 465
            :.:.:||:|      :|.|:..::  |||.||...|      :..:|..:|..:.....|   |.
plant   351 QSDKKLELLSFFMIELCLVEYEMLQYTPSQLAASAI------YTAQSTLKGYEDWSKTSE---FH 406

  Fly   466 QQYMRIPDRVFTCGFSIVSGILSHYNGQNK 495
            ..|..  :.:..|...:|.  |.|..|..|
plant   407 SGYTE--EALLECSRKMVG--LHHKAGTGK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 20/78 (26%)
CYCB2;4NP_001323249.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.