DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCD1;1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_177178.1 Gene:CYCD1;1 / 843357 AraportID:AT1G70210 Length:339 Species:Arabidopsis thaliana


Alignment Length:245 Identity:49/245 - (20%)
Similarity:99/245 - (40%) Gaps:44/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 EAGAVGGASNNNGESSSSLKKLEDQLHALTSDELYETLKEYDVLQDKFHTVLLLPKESRREVTAG 271
            ::|...|.|..:..||.......|.:.....||.: .:..:|.| .:|.|         |.:.|.
plant    27 DSGVFSGESTVDFSSSEVDSWPGDSIACFIEDERH-FVPGHDYL-SRFQT---------RSLDAS 80

  Fly   272 GRDGS-AYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKPKH---MACMSVASFHLAIKQLDL 332
            .|:.| |::|: ::.:|.......:.|::.:||||....:....   |..::||...||.|   :
plant    81 AREDSVAWILK-VQAYYNFQPLTAYLAVNYMDRFLYARRLPETSGWPMQLLAVACLSLAAK---M 141

  Fly   333 KPIPAEDLVTISQCGC----TAGDLERMAGVIANKLGVQMGHAPITSVSYLRIY-YALFRNLAKE 392
            :.|....|......|.    .|..::||..::.:.|..::  ..:|...::..: |.:      :
plant   142 EEILVPSLFDFQVAGVKYLFEAKTIKRMELLVLSVLDWRL--RSVTPFDFISFFAYKI------D 198

  Fly   393 IGGDFFKFYQQLIKLEELENRLEILMCDVKTTVIT---PSTL-ALVLICL 438
            ..|.|..|:        :.:..||::.::|.....   ||:: |..::|:
plant   199 PSGTFLGFF--------ISHATEIILSNIKEASFLEYWPSSIAAAAILCV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 18/84 (21%)
CYCD1;1NP_177178.1 Cyclin_N 50..182 CDD:365896 32/148 (22%)
Cyclin_C 184..308 CDD:367282 12/71 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.