DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCA3;2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_564499.3 Gene:CYCA3;2 / 841124 AraportID:AT1G47210 Length:372 Species:Arabidopsis thaliana


Alignment Length:293 Identity:68/293 - (23%)
Similarity:113/293 - (38%) Gaps:67/293 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 QKYEQQQQLEDLAESEAGAVGGA--SNNNGESSSSLKKLED--QLHALTSDELYETLKEYDV--- 249
            ||.|.|:...:|....|..:..|  :..:.||.|.:....|  |:......::||.|::.:|   
plant    54 QKKETQKPKRNLKPPPAKQIKSAPVAIIDLESKSDIDSRSDDPQMCGPYVADIYEYLRQLEVKPK 118

  Fly   250 ---LQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMW-------YELPSDVLFSAMSLVDRF 304
               |.|....|       :::||...|.       .|..|       |:|.|:.|:..:|.:|||
plant   119 QRPLPDYIEKV-------QKDVTPSMRG-------VLVDWLVEVAEEYKLGSETLYLTVSHIDRF 169

  Fly   305 LDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMG 369
            |....|..:.:..:.|::..:|.|..::.|...:|...|:....:..|:.:|...|...|..::|
plant   170 LSLKTVNKQKLQLVGVSAMLIASKYEEISPPKVDDFCYITDNTFSKQDVVKMEADILLALQFELG 234

  Fly   370 HAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILMC--------DVKTTVI 426
            ...|.:      :...|..:|::   ||        |:..|:  ||.|.|        |.||...
plant   235 RPTINT------FMRRFTRVAQD---DF--------KVPHLQ--LEPLCCYLSELSILDYKTVKF 280

  Fly   427 TPSTLALVLICL---------HLDFHIKESYTR 450
            .||.||...:.|         |....:.|.||:
plant   281 VPSLLAASAVFLARFIIRPKQHPWNQMLEEYTK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 19/77 (25%)
CYCA3;2NP_564499.3 COG5024 <88..352 CDD:227357 58/259 (22%)
Cyclin_N 105..234 CDD:365896 32/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.