DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCB2;3

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_173485.1 Gene:CYCB2;3 / 838650 AraportID:AT1G20610 Length:429 Species:Arabidopsis thaliana


Alignment Length:154 Identity:34/154 - (22%)
Similarity:66/154 - (42%) Gaps:32/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAG 351
            :||..:.|:..::::||||....:..|.:..:.|.:..||.|..::.....:||:.||....:..
plant   224 FELMEETLYLTINVIDRFLAVHQIVRKKLQLVGVTALLLACKYEEVSVPVVDDLILISDKAYSRR 288

  Fly   352 DLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEI 416
            ::..|..::||.|  |...:..|.                      :.|.::.:|..:.:.:|||
plant   289 EVLDMEKLMANTL--QFNFSLPTP----------------------YVFMKRFLKAAQSDKKLEI 329

  Fly   417 L------MCDVKTTVI--TPSTLA 432
            |      :|.|:..::  .||.||
plant   330 LSFFMIELCLVEYEMLEYLPSKLA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 19/77 (25%)
CYCB2;3NP_173485.1 Cyclin_N 180..304 CDD:278560 21/81 (26%)
Cyclin_C 308..425 CDD:281044 13/68 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.