DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and SDS

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001322548.1 Gene:SDS / 838040 AraportID:AT1G14750 Length:619 Species:Arabidopsis thaliana


Alignment Length:338 Identity:60/338 - (17%)
Similarity:119/338 - (35%) Gaps:107/338 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 ESSSSLKKLEDQLHALTSDELYETLKEYDVLQDKFHTVL---------------LLPKESRREVT 269
            |..|.|.:.:|:    ..:|.|..|:|    :::.|..:               |:|:  .|.:.
plant   336 EIHSELLRFDDE----EVEESYLRLRE----RERSHAYMRDCAKAYCSRMDNTGLIPR--LRSIM 390

  Fly   270 AGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKPKH-MACMSVASFHLAIKQLDLK 333
            .     ...|.:|..|  .|..:.||..:.|:||||.:.:.|.:. :..:.:||..||.:..:.:
plant   391 V-----QWIVKQCSDM--GLQQETLFLGVGLLDRFLSKGSFKSERTLILVGIASLTLATRIEENQ 448

  Fly   334 PIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGG--- 395
            |..:                            ::..:..|.::.|.|........|.:|:..   
plant   449 PYNS----------------------------IRKRNFTIQNLRYSRHEVVAMEWLVQEVLNFKC 485

  Fly   396 ------DFFKFYQQLIKLE-ELENRLEIL----MCDVKTTVITPSTLALVLICLHLDFHIKESYT 449
                  :|..||.:..:.. |:|.:.:.|    :.|.......|||:|..|:.|....|.|    
plant   486 FTPTIFNFLWFYLKAARANPEVERKAKSLAVTSLSDQTQLCFWPSTVAAALVVLACIEHNK---- 546

  Fly   450 RGSPELKHVFEYILFLQQYMRIPD-------RVFTCGFSIVSGILSHYNGQNK--------APYK 499
                    :..|...::.::|..|       :||:...|:.:.::  :..:.|        .||.
plant   547 --------ISAYQRVIKVHVRTTDNELPECVKVFSVTLSLYTNLI--FTTKRKVSDCFHIFVPYT 601

  Fly   500 QR---LVWKLSSR 509
            ..   :.|.:|::
plant   602 TESGLVAWAVSNQ 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 14/78 (18%)
SDSNP_001322548.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.