DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCD4;1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001190620.1 Gene:CYCD4;1 / 836667 AraportID:AT5G65420 Length:318 Species:Arabidopsis thaliana


Alignment Length:193 Identity:40/193 - (20%)
Similarity:73/193 - (37%) Gaps:61/193 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 LKKLEDQLHALTSDELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLR-------- 281
            ::.:|.:...|.||:..:.|:..|:                 ::..|.||...::.:        
plant    48 MEMVEKEKQHLPSDDYIKRLRSGDL-----------------DLNVGRRDALNWIWKIRGLCRTD 95

  Fly   282 --------------CLKMWYELPSDVLFSAMSLVDRFL---DRMAVKPKHMACMSVASFHLAIKQ 329
                          ||             ||:.:||||   |..:.|...:..::||...||.|.
plant    96 REACEVHQFGPLCFCL-------------AMNYLDRFLSVHDLPSGKGWILQLLAVACLSLAAKI 147

  Fly   330 LDLK-PIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAK 391
            .:.: |:..:..|...|....|..::||..::.|||..::  ..||..||:|.:   .|.::|
plant   148 EETEVPMLIDLQVGDPQFVFEAKSVQRMELLVLNKLKWRL--RAITPCSYIRYF---LRKMSK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 21/81 (26%)
CYCD4;1NP_001190620.1 Cyclin_N 45..188 CDD:278560 33/171 (19%)
Cyclin_C 191..>282 CDD:281044 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.