DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCA3;1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_199122.1 Gene:CYCA3;1 / 834324 AraportID:AT5G43080 Length:355 Species:Arabidopsis thaliana


Alignment Length:271 Identity:65/271 - (23%)
Similarity:114/271 - (42%) Gaps:61/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 ASNNNGESSSSLKKLEDQLHALTSD----------------ELYETLKEYDVLQDKFHTVLLLPK 262
            |:....:.|.|:..:|    .|.||                .::|.|::.:|   |...::...:
plant    53 ATTKQKKKSVSIPTIE----TLNSDIDTRSDDPQMCGPYVTSIFEYLRQLEV---KSRPLVDYIE 110

  Fly   263 ESRREVTAGGRDGSAYVLRCLKMW-------YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSV 320
            :.:::||:..|.       .|..|       |:|.||.|:.|:|.:||||....|..:.:..:.|
plant   111 KIQKDVTSNMRG-------VLVDWLVEVAEEYKLLSDTLYLAVSYIDRFLSLKTVNKQRLQLLGV 168

  Fly   321 ASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYAL 385
            .|..:|.|..::.|...:|...|:....|..::.:|...|...|..::|:.  ||.::||    .
plant   169 TSMLIASKYEEITPPNVDDFCYITDNTYTKQEIVKMEADILLALQFELGNP--TSNTFLR----R 227

  Fly   386 FRNLAKEIGGDFFKFYQQLIKLEELENRL-EILMCDVKTTVITPSTLALVLICLHLDFHIK---- 445
            |..:|:|      .|....:::|.|.:.| |:.|.|.::....|||:|...:.| ..|.|:    
plant   228 FTRVAQE------DFEMSHLQMEFLCSYLSELSMLDYQSVKFLPSTVAASAVFL-ARFIIRPKQH 285

  Fly   446 ------ESYTR 450
                  |.|||
plant   286 PWNVMLEEYTR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 22/77 (29%)
CYCA3;1NP_199122.1 Cyclin_N 91..217 CDD:278560 32/135 (24%)
Cyclin_C 219..342 CDD:281044 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.