DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYC3B

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_568248.2 Gene:CYC3B / 831001 AraportID:AT5G11300 Length:436 Species:Arabidopsis thaliana


Alignment Length:296 Identity:59/296 - (19%)
Similarity:110/296 - (37%) Gaps:53/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 EQQQQLEDLAESEAGAVGGASNNNGESSSSLKKLEDQLHALTSDELYETLKEYDV---------- 249
            |:.:..|||::.........|.:|.:.....::.||      ...:.|.|:..|:          
plant   111 EKSKLAEDLSKIRMAEAQDVSLSNFKDEEITEQQED------GSGVMELLQVVDIDSNVEDPQCC 169

  Fly   250 ------LQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMW-------YELPSDVLFSAMSLV 301
                  :.|..|...|..:.....:....||....:.:.|..|       |:|..|.|:..::|:
plant   170 SLYAADIYDNIHVAELQQRPLANYMELVQRDIDPDMRKILIDWLVEVSDDYKLVPDTLYLTVNLI 234

  Fly   302 DRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGV 366
            ||||....::.:.:..:.|:...:|.|..:|.....|:...|:....|..::..|...|.|.:..
plant   235 DRFLSNSYIERQRLQLLGVSCMLIASKYEELSAPGVEEFCFITANTYTRPEVLSMEIQILNFVHF 299

  Fly   367 QMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQ-----QLIKLEELENRL-EILMCDVKTTV 425
            ::. .| |:.::||               .|.|..|     ..|:||.|.|.| |:.:.:.....
plant   300 RLS-VP-TTKTFLR---------------RFIKAAQASYKVPFIELEYLANYLAELTLVEYSFLR 347

  Fly   426 ITPSTLALVLICLHLDFHIKESYTRGSPELKHVFEY 461
            ..||.:|...:.| ..:.:.::....:|.|:|...|
plant   348 FLPSLIAASAVFL-ARWTLDQTDHPWNPTLQHYTRY 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 19/77 (25%)
CYC3BNP_568248.2 COG5024 4..418 CDD:227357 59/296 (20%)
Cyclin_N 175..302 CDD:365896 26/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.