DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCD4;2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_196606.3 Gene:CYCD4;2 / 830908 AraportID:AT5G10440 Length:298 Species:Arabidopsis thaliana


Alignment Length:195 Identity:42/195 - (21%)
Similarity:88/195 - (45%) Gaps:32/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 SNNNGESSSSL--KKLEDQLHALTSDELYETLKEYDVLQDKFHTVLLLPKES-RREVTAGGRDGS 276
            ||.:.|.|:|:  :.:......|.|:|:...:.|    :::.|:    |::. .:.:..|..|.:
plant    11 SNFDDEKSNSVDTRSIFQMGFPLESEEIVREMIE----KERQHS----PRDDYLKRLRNGDLDFN 67

  Fly   277 AYVLRCLKMWYELPSDVLFS------AMSLVDRFL---DRMAVKPKHMACMSVASFHLAIKQLDL 332
            ..: :.|...::...::.|.      ||:.:||||   |..:.|...:..::||...||.| ::.
plant    68 VRI-QALGWIWKACEELQFGPLCICLAMNYLDRFLSVHDLPSGKAWTVQLLAVACLSLAAK-IEE 130

  Fly   333 KPIPAEDLVTISQCGC-----TAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKE 392
            ..:|  :|:.: |.|.     .|..::||..::.|.|..::  ..:|..||:|.:.:......:|
plant   131 TNVP--ELMQL-QVGAPMFVFEAKSVQRMELLVLNVLRWRL--RAVTPCSYVRYFLSKINGYDQE 190

  Fly   393  392
            plant   191  190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 22/91 (24%)
CYCD4;2NP_196606.3 Cyclin_N 37..169 CDD:278560 30/146 (21%)
Cyclin_C 171..281 CDD:281044 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.