DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYC1BAT

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_196233.1 Gene:CYC1BAT / 830502 AraportID:AT5G06150 Length:445 Species:Arabidopsis thaliana


Alignment Length:282 Identity:56/282 - (19%)
Similarity:99/282 - (35%) Gaps:77/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 DELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKM-W-------YELPSDVL 294
            |::|...||.:             |||:.::....:......:|.:.: |       :||..:.|
plant   184 DDMYSFYKEVE-------------KESQPKMYMHIQTEMNEKMRAILIDWLLEVHIKFELNLETL 235

  Fly   295 FSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGV 359
            :..::::||||...||..:.:..:.:::..:|.|..::.|....|||.::....::..:..|...
plant   236 YLTVNIIDRFLSVKAVPKRELQLVGISALLIASKYEEIWPPQVNDLVYVTDNAYSSRQILVMEKA 300

  Fly   360 IANKLGVQMGHAPITSVSYLRI---YYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEIL---- 417
            |...|           ..||.:   |..|.|            |.:..:...|:||.:..|    
plant   301 ILGNL-----------EWYLTVPTQYVFLVR------------FIKASMSDPEMENMVHFLAELG 342

  Fly   418 MCDVKTTVITPSTLALVLI----CL---------HLDFHIKESYTRGSPELKHVFEYILFLQQYM 469
            |....|....||.||...:    |.         .|.||  ..||..  |:....:.:.||..  
plant   343 MMHYDTLTFCPSMLAASAVYTARCSLNKSPAWTDTLQFH--TGYTES--EIMDCSKLLAFLHS-- 401

  Fly   470 RIPDRVFTCGFSIVSGILSHYN 491
                   .||.|.:..:...|:
plant   402 -------RCGESRLRAVYKKYS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 17/77 (22%)
CYC1BATNP_196233.1 CYCLIN_AtCycB-like_rpt1 162..307 CDD:410270 27/146 (18%)
CYCLIN_AtCycB-like_rpt2 312..428 CDD:410215 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.