DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCB2;2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_195287.1 Gene:CYCB2;2 / 829714 AraportID:AT4G35620 Length:429 Species:Arabidopsis thaliana


Alignment Length:402 Identity:77/402 - (19%)
Similarity:138/402 - (34%) Gaps:121/402 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AYYCQLQAARQQEQLMQQRTSMS--SSVMPGLALPQDHQDHPAALLNGPHNNNIGLAMDAHSINA 115
            ||.|.:...|...|..|:.....  .|:.|.::..|:......     |..|..|        :.
plant    54 AYPCVVNKRRGLSQRKQESCDKKKLDSLHPSISRSQEETKKLK-----PSGNEFG--------DC 105

  Fly   116 ILVDDEQPSTSAQAAAAAAASAGGSAGAGSGSGLGGAIGGGKLANGINRNAEMPTDW-MRIADEG 179
            |.:|:|:                                        .:|.|:..|. |.::.|.
plant   106 IFIDEEE----------------------------------------EKNEEVTLDQPMPMSLEE 130

  Fly   180 RYGTPGAAGLEYQKYEQQQQLEDLAESEAGAVGGASNNNGESS-SSLKKLEDQLHALTSDELYET 243
            .|       :|:...|::.::||:.|.:...|......:..:| ::::.::|........|.:..
plant   131 PY-------IEFDPMEEEVEMEDMEEEQEEPVLDIDEYDANNSLAAVEYVQDLYDFYRKTERFSC 188

  Fly   244 L------KEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMW-------YELPSDVLF 295
            :      :::|: .||...:|:                         .|       :||.::.||
plant   189 VPLDYMAQQFDI-SDKMRAILI-------------------------DWLIEVHDKFELMNETLF 227

  Fly   296 SAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVI 360
            ..::|:||||.:.||..|.:..:.:.:..||.|..::.....||||.||....|..|:..|..::
plant   228 LTVNLIDRFLSKQAVARKKLQLVGLVALLLACKYEEVSVPIVEDLVVISDKAYTRTDVLEMEKIM 292

  Fly   361 ANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRL-EILMCDVKTT 424
            .:.|...|.         |...|...:.        |.|..|...|||.|.:.| |:.:.|.:..
plant   293 LSTLQFNMS---------LPTQYPFLKR--------FLKAAQSDKKLEILASFLIELALVDYEMV 340

  Fly   425 VITPSTLALVLI 436
            ...||.||...:
plant   341 RYPPSLLAATAV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 24/77 (31%)
CYCB2;2NP_195287.1 COG5024 <157..412 CDD:227357 50/239 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.