DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCD3;1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_195142.1 Gene:CYCD3;1 / 829564 AraportID:AT4G34160 Length:376 Species:Arabidopsis thaliana


Alignment Length:198 Identity:41/198 - (20%)
Similarity:82/198 - (41%) Gaps:37/198 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 YEQQQQLEDLAESEAGAVGGASNNNGESSSSLKKLEDQLHALTSDELYETLKEYDVLQDKFHTVL 258
            |.::::.:|..|..            |.:|||.........|..|..:|   :.|:       |.
plant    23 YCEEEKWDDEGEEV------------EENSSLSSSSSPFVVLQQDLFWE---DEDL-------VT 65

  Fly   259 LLPKESRR--------EVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAV---KP 312
            |..||..:        .::...::...::|| :...|...:.....|::.:|:|:...::   ||
plant    66 LFSKEEEQGLSCLDDVYLSTDRKEAVGWILR-VNAHYGFSTLAAVLAITYLDKFICSYSLQRDKP 129

  Fly   313 KHMACMSVASFHLAIKQLDLK-PIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSV 376
            ..:..:|||...||.|..:.: |:..:..|..::....|..::||..:|.:.|..:| |. ||.:
plant   130 WMLQLVSVACLSLAAKVEETQVPLLLDFQVEETKYVFEAKTIQRMELLILSTLEWKM-HL-ITPI 192

  Fly   377 SYL 379
            |::
plant   193 SFV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 18/81 (22%)
CYCD3;1NP_195142.1 CYCLIN_AtCycD-like_rpt1 86..184 CDD:410246 21/98 (21%)
CYCLIN_AtCycD-like_rpt2 189..279 CDD:410247 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.