DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCD6;1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_192236.1 Gene:CYCD6;1 / 828000 AraportID:AT4G03270 Length:302 Species:Arabidopsis thaliana


Alignment Length:177 Identity:42/177 - (23%)
Similarity:73/177 - (41%) Gaps:43/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 LHALTSDEL-YETLK------EYDVLQDK--FHTV----LLLPKESR--REVTAGGRDGSAYVLR 281
            ||...:|:. ||||.      |:..:...  ||::    .||...::  ..:|...|.       
plant    14 LHNNFNDDTDYETLPHSLFLVEFQHMPSSHYFHSLKSSAFLLSNRNQAISSITQYSRK------- 71

  Fly   282 CLKMWYELPSDVLFSAMSLVDRFL---DRMAVKPKHMACMSVASFHLAIK----QLDLKPIPAED 339
                 ::.|| :.:.|::.:||||   |....||..:..:|::...|:.|    .:.:..:|.|.
plant    72 -----FDDPS-LTYLAVNYLDRFLSSEDMPQSKPWILKLISLSCVSLSAKMRKPDMSVSDLPVEG 130

  Fly   340 LVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALF 386
            ....:|.      :|||..||...|..:|  ..:|..|:|..:.:||
plant   131 EFFDAQM------IERMENVILGALKWRM--RSVTPFSFLAFFISLF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 21/84 (25%)
CYCD6;1NP_192236.1 Cyclin_N 29..154 CDD:278560 30/145 (21%)
Cyclin_C 156..>252 CDD:281044 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.