DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCB1;4

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_180244.1 Gene:CYCB1;4 / 817217 AraportID:AT2G26760 Length:387 Species:Arabidopsis thaliana


Alignment Length:246 Identity:45/246 - (18%)
Similarity:84/246 - (34%) Gaps:75/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GLGGAIGGGKLANGINRNAEMPTDWMRIADEGRY--GTPGAAGLEYQKYEQQQQLEDLAE----- 205
            |:.|.|....:|....:|.::      :.|.|..  |...|.|.:..|..:|.|.:..||     
plant    14 GIAGEIKPKNVAGHGRQNRKV------LGDIGNLVTGRDVATGKDVAKKAKQPQQQTKAEVIVIS 72

  Fly   206 -----------SEAGAVGGAS------NNNGESSSSLKKLEDQLHALTSD-------------EL 240
                       |....:.|..      ....:::|.||.....:.|:.::             :.
plant    73 PDENEKCKPHFSRRTHIRGTKTFTATLRARSKAASGLKDAVIDIDAVDANNELAAVEYVEDIFKF 137

  Fly   241 YETLKEYDVLQD----------KFHTVLL--LPKESRREVTAGGRDGSAYVLRCLKMWYELPSDV 293
            |.|::|...::|          |..::|:  |....|:                    :||..:.
plant   138 YRTVEEEGGIKDYIGSQPEINEKMRSILIDWLVDVHRK--------------------FELMPET 182

  Fly   294 LFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTIS 344
            |:..::||||||....|..:.:..:.:.:..:|.|..::......|.|.||
plant   183 LYLTINLVDRFLSLTMVHRRELQLLGLGAMLIACKYEEIWAPEVNDFVCIS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 16/58 (28%)
CYCB1;4NP_180244.1 CYCLIN_AtCycB-like_rpt1 110..255 CDD:410270 26/144 (18%)
CYCLIN_AtCycB-like_rpt2 260..377 CDD:410215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.