DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCD2;1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001189576.1 Gene:CYCD2;1 / 816782 AraportID:AT2G22490 Length:362 Species:Arabidopsis thaliana


Alignment Length:190 Identity:37/190 - (19%)
Similarity:72/190 - (37%) Gaps:48/190 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 ASNNNGESSSSLKKLEDQLHALTSDELYETL-KEYDVLQDKFHTVLLLPKESRREVTAGGRDGSA 277
            |.::|...:.|:..:.....:|:.|.:.|.| :|.:......:...||..:....|.....|   
plant    41 AKDDNFGGNGSIPMMGSSSSSLSEDRIKEMLVREIEFCPGTDYVKRLLSGDLDLSVRNQALD--- 102

  Fly   278 YVLR------------CLKM--------WYELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVAS 322
            ::|:            ||.|        .||||.|..::|..|.             ::|:|:||
plant   103 WILKVCAHYHFGHLCICLSMNYLDRFLTSYELPKDKDWAAQLLA-------------VSCLSLAS 154

  Fly   323 FHLAIKQLDLKPI---PAEDLVTISQCGCTAGDLERMAGVIANKLGVQM-GHAPITSVSY 378
               .:::.|:..|   ..||...:.:    |..::||..::...|..:: ...|.:.:.|
plant   155 ---KMEETDVPHIVDLQVEDPKFVFE----AKTIKRMELLVVTTLNWRLQALTPFSFIDY 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 18/80 (23%)
CYCD2;1NP_001189576.1 Cyclin_N 65..196 CDD:278560 31/153 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.