DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CYCB2;1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_179353.1 Gene:CYCB2;1 / 816269 AraportID:AT2G17620 Length:429 Species:Arabidopsis thaliana


Alignment Length:291 Identity:59/291 - (20%)
Similarity:101/291 - (34%) Gaps:89/291 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 ESSSSLKKLE--DQLHALTSDELYETLKEYDV-----------LQDKFHTVLLLPKESRREVTAG 271
            :|.:||..:|  ..|:|     .|.|::.:..           |.:|...:|:            
plant   161 DSKNSLAAVEYVQDLYA-----FYRTMERFSCVPVDYMMQQIDLNEKMRAILI------------ 208

  Fly   272 GRDGSAYVLRCLKMW-------YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQ 329
                         .|       ::|.::.||..::|:||||.:..|..|.:..:.:.:..||.|.
plant   209 -------------DWLIEVHDKFDLINETLFLTVNLIDRFLSKQNVMRKKLQLVGLVALLLACKY 260

  Fly   330 LDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIG 394
            .::.....||||.||....|..|:..|...:.:.|  |...:..|...:|:              
plant   261 EEVSVPVVEDLVLISDKAYTRNDVLEMEKTMLSTL--QFNISLPTQYPFLK-------------- 309

  Fly   395 GDFFKFYQQLIKLEELENRL-EILMCDVKTTVITPSTLALVLICLHLDFHIKESYTR-----GSP 453
             .|.|..|...|.|.|.:.| |:.:.:.:.....||.||...:           ||.     ||.
plant   310 -RFLKAAQADKKCEVLASFLIELALVEYEMLRFPPSLLAATSV-----------YTAQCTLDGSR 362

  Fly   454 ELKHVFEYILFLQQYMRIPDRVFTCGFSIVS 484
            :.....|:.....:     |::..|...:||
plant   363 KWNSTCEFHCHYSE-----DQLMECSRKLVS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 22/77 (29%)
CYCB2;1NP_179353.1 Cyclin_N 174..300 CDD:278560 32/157 (20%)
Cyclin_C 302..419 CDD:281044 23/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.