DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccnd2a

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001082914.1 Gene:ccnd2a / 799608 ZFINID:ZDB-GENE-070424-30 Length:298 Species:Danio rerio


Alignment Length:310 Identity:58/310 - (18%)
Similarity:105/310 - (33%) Gaps:93/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 RDGSAYVLRCLKMW-------YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQL 330
            :|...::.|.:..|       .:...:|...||:.:||||..:..:..::..:......||.|..
Zfish    49 KDIQPFMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTRKCNLQLLGAVCMFLASKLK 113

  Fly   331 DLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGG 395
            :.:|:.||.|...:.......:|.....|:..||.                     .|||.....
Zfish   114 ETRPLTAEKLCIYTDNSIRPQELLEWELVVLGKLK---------------------WNLAAVTPN 157

  Fly   396 DFFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLALVLICLHLDFHIKESYTRGSPELKHVFE 460
            ||.:...:  ||...|::||::...|:|.:...:|          ||:..               
Zfish   158 DFIEHIMR--KLPLPEDKLELIRKHVQTFIALCAT----------DFNFA--------------- 195

  Fly   461 YILFLQQYMRIPDRVFT-------CGFSIVSGILSHYNGQNKAPYKQRLVWKLSSRTLRVLRPIN 518
                    |..|..:.|       ||..:.|...|.: |.|..    .|:.|:::..:.||:...
Zfish   196 --------MYPPSMIATGSVAAAICGLQLNSTNHSLW-GDNLT----ELLAKITNTEVDVLKACQ 247

  Fly   519 RFSSDLPTIEEGIPNALDDGLR------------SRTESISSEEEEDWPT 556
            .      .||..:.|.|.:|.|            .|::::..:::...||
Zfish   248 E------QIERVLMNNLREGRRQQQKQQQQEQGGQRSKALDDQDQSSTPT 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 17/77 (22%)
ccnd2aNP_001082914.1 Cyclin_N 26..152 CDD:278560 22/123 (18%)
Cyclin_C 154..>257 CDD:281044 27/148 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.