DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CCNP

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_006723458.2 Gene:CCNP / 79935 HGNCID:25805 Length:397 Species:Homo sapiens


Alignment Length:267 Identity:61/267 - (22%)
Similarity:97/267 - (36%) Gaps:45/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PSTSAQAAAAAAASAGGSAGAGSGSGLGGAIGGGKLANGINRNAEMPTDWMRIADEGRYGTPGAA 187
            ||...:..|:.|..:......|...|     .|.:|...:.|.|..|:....:          ||
Human    52 PSCKGRCLASPATPSWRMLVRGRDQG-----SGSRLGPIVRRWAPRPSPLQSL----------AA 101

  Fly   188 GLEYQKYEQQQQLEDLAESEAGAVGGASNNNGESSSSLKK---LEDQLHALTSDELYETLKEY-- 247
            .|            |...|.|....|.......|...|.:   ||:.|.||.    .:..:||  
Human   102 SL------------DAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALG----LQGEREYAG 150

  Fly   248 DVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMWYE---LPSDVLFSAMSLVDRFLDRMA 309
            |:..:.....:|..:...|.||...|   |.|:..|...:|   |..|.|:.|:.|:|.:|....
Human   151 DIFAEVMVCRVLPLRALPRAVTPEMR---ALVVDWLVQVHEYLGLAGDTLYLAVHLLDSYLSAGR 212

  Fly   310 VKPKHMACMSVASFHLAIKQLD-LKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGH-AP 372
            |:...:..:.||...:|.|..: :.|.|| .|..:|....:..:|.|....|.::|..::.| .|
Human   213 VRLHRLQLLGVACLFVACKMEECVLPEPA-FLCLLSADSFSRAELLRAERRILSRLDFRLHHPGP 276

  Fly   373 ITSVSYL 379
            :..:..|
Human   277 LLCLGLL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 21/81 (26%)
CCNPXP_006723458.2 Cyclin_N 171..271 CDD:278560 28/103 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.