DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CCNJL

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_078841.3 Gene:CCNJL / 79616 HGNCID:25876 Length:435 Species:Homo sapiens


Alignment Length:375 Identity:76/375 - (20%)
Similarity:129/375 - (34%) Gaps:113/375 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 SDELYETLKEYDVLQDKF--HTVLLLPKESRREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMS 299
            :.:::.||:|.::....|  |:.||   :|||....        :|..|....:|.......|:.
Human    12 ASDVHCTLREKELKLPTFRAHSPLL---KSRRFFVD--------ILTLLSSHCQLCPAARHLAVY 65

  Fly   300 LVDRFLDRMAV-KPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANK 363
            |:|.|:||..| ..|.:..::|:...||.....|.|          :..|        :|:|:..
Human    66 LLDHFMDRYNVTTSKQLYTVAVSCLLLANGVSLLSP----------RLKC--------SGMISAH 112

  Fly   364 LGVQM----------GHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILM 418
            ..:.:          .|.|.|...            ..|..|.|......:.|||:: |...||.
Human   113 CNLHLPGSSNSPASAPHPPPTPPQ------------VAETTGKFEDREDHVPKLEQI-NSTRILS 164

  Fly   419 CD----VKTTVITPSTLALVL----ICLHLDFHIKESYTRGSPELK----HVF------------ 459
            ..    .|..:::...|.|..    :||....|..:.|...|...|    |.:            
Human   165 SQNFTLTKKELLSTELLLLEAFSWNLCLPTPAHFLDYYLLASVSQKDHHCHTWPTTCPRKTKECL 229

  Fly   460 -EYI-LFLQQYMRIPDRVF----------TC-GFSIVSGILSHYNGQNKAPYKQRLVWKLSSRTL 511
             ||. .||:  :.:.|.:|          .| |.|.:...||        ||..|.:.::||.:|
Human   230 KEYAHYFLE--VTLQDHIFYKFQPSVVAAACVGASRICLQLS--------PYWTRDLQRISSYSL 284

  Fly   512 RVLRPINRFSSDLPTIEEGIPNALDDGLRSRTESISSEEEEDWPTSPIIP 561
            ..|      |:.:..:.....|.|.|.:..::::::..     |.:|..|
Human   285 EHL------STCIEILLVVYDNVLKDAVAVKSQALAMV-----PGTPPTP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 17/78 (22%)
CCNJLNP_078841.3 CYCLIN 14..>93 CDD:294043 22/89 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..142 4/33 (12%)
Cyclin_C 193..>295 CDD:281044 24/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.