DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CCNI2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001274181.1 Gene:CCNI2 / 645121 HGNCID:33869 Length:385 Species:Homo sapiens


Alignment Length:365 Identity:89/365 - (24%)
Similarity:135/365 - (36%) Gaps:86/365 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 QPSTSAQAAAAAAASAGGSAGAG-----SGSGLGGAIGGGKLANGINRNAEMPTDWMRIADEGRY 181
            |||:|   ..:|..|.||..|||     .|..|..:.|...|... || :..|            
Human    10 QPSSS---EVSAVQSPGGRPGAGLEETALGVPLPPSPGEAPLPRS-NR-SRCP------------ 57

  Fly   182 GT--PGAAGLEYQKYE---QQQQLEDLAESEAGAVGGASNNN----GESSSSLKKLEDQLH---- 233
            ||  ||||.|......   :.::....|...|.||..|:...    ...|...:.||..|.    
Human    58 GTRQPGAASLHAASAAVPVRPRRGTAPAGKTADAVPAAAPEQAPRPAPQSRKPRNLEGDLDERRL 122

  Fly   234 ----ALTSD---ELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMWYELPS 291
                .|..|   .|:...|..|.:.|.|..|:|                  ::||....:|.  |
Human   123 LCHLQLAQDREARLWRGGKPQDEICDAFEEVVL------------------WLLRLQNTFYF--S 167

  Fly   292 DVLFS-AMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKP-IP-AEDLVTISQCGCTAGDL 353
            ...|: |:::..|.|..:.||.|::.|.::.|..||.|..:.:. || .:|.........:..:|
Human   168 QSTFNLALTIFGRLLISVKVKEKYLHCATITSLRLAAKVNEEEEFIPQVKDFTKHYGSDYSPNEL 232

  Fly   354 ERMAGVIANKL--GVQMGHAPITSVSYLRI-YYALFRNLAKEIGGDFFKF----YQQLIKL---- 407
            .||...|.::|  .:.:|    |.:.:|.| .|.:|.:..|..|..|...    :..:::|    
Human   233 LRMELAILDRLHWDLYIG----TPLDFLTIEKYGVFCSNIKNHGLQFHALVVLSWPHVLELLPQR 293

  Fly   408 ------EELENRLEILMCDVKTTVITPSTLALVLICLHLD 441
                  ..|..:|:..|...:......||||||:|.|.|:
Human   294 NPSLHVASLTRQLQHCMAGHQLLQFKGSTLALVIITLELE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 22/82 (27%)
CCNI2NP_001274181.1 Cyclin_N <156..247 CDD:278560 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.