DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccnd2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_071603.2 Gene:Ccnd2 / 64033 RGDID:621083 Length:288 Species:Rattus norvegicus


Alignment Length:217 Identity:48/217 - (22%)
Similarity:77/217 - (35%) Gaps:45/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 DELYETLKEYDVLQDKFHTVLL------LPKESRREVTAGGRDGSAYVLRCLKMW-------YEL 289
            |.:...:.:.::|:|:....||      ||:.|..:...  :|...|:.|.:..|       .:.
  Rat     9 DPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQ--KDIQPYMRRMVATWMLEVCEEQKC 71

  Fly   290 PSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLE 354
            ..:|...||:.:||||..:.....|:..:......||.|..:..|:.||.|...:.......:|.
  Rat    72 EEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSVKPQELL 136

  Fly   355 RMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFF-----KFYQQLIKLEELENRL 414
            ....|:..||.                     .|||.....||.     |..||..||..:....
  Rat   137 EWELVVLGKLK---------------------WNLAAVTPHDFIEHILRKLPQQKEKLSLIRKHA 180

  Fly   415 E--ILMC--DVKTTVITPSTLA 432
            :  |.:|  |.|..:..||.:|
  Rat   181 QTFIALCATDFKFAMYPPSMIA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 18/77 (23%)
Ccnd2NP_071603.2 CYCLIN_SF 1..149 CDD:424085 31/162 (19%)
CYCLIN_CCND2_rpt2 154..258 CDD:410280 14/49 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.