DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccnp

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001038424.1 Gene:ccnp / 561391 ZFINID:ZDB-GENE-030131-5453 Length:398 Species:Danio rerio


Alignment Length:314 Identity:59/314 - (18%)
Similarity:109/314 - (34%) Gaps:85/314 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 GGKLANGINRNAEMPTDWMR----------IADEGRYGTPGAAGLEYQKYEQQQQLEDL------ 203
            |.::.:|.:......:.|::          |.|....|.|.::.:    ||::..|:.|      
Zfish    43 GEEVGSGQHYKPAQESRWVQRLPISAEDGIIMDYAPQGEPTSSDV----YEEEALLKYLNRLPGP 103

  Fly   204 ---AESEAGAVGGASNNNGESSSSLKKLEDQLHALTSDELYETLKEYDVLQDKFHTVLL------ 259
               .|...|.:      ..|...::.||     .|..|:.|    .:|:..|...:.||      
Zfish   104 LSFQELMPGLL------RREVEVAISKL-----GLLFDKTY----AWDIFSDMMRSQLLCTLPNA 153

  Fly   260 -LPK---ESRREVTAGGRDGSAYVLRCLKMW-------YELPSDVLFSAMSLVDRFLDRMAVKPK 313
             |||   ::.|.:              |..|       ::...:.|:..:.|::|.|..:.|...
Zfish   154 DLPKPFTDTTRAI--------------LVDWLIQVHEVFQFSEETLYLTVHLLNRALRLIKVSIS 204

  Fly   314 HMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSY 378
            .:..:.|....||.|:.:.......:|..:.:...:...|.||...:...|...:.|.|  .:.:
Zfish   205 GLQLLGVVCLFLAAKREECLLPEVSELCYLMENAYSKKQLLRMERRVLIGLKFDLYHCP--PLHF 267

  Fly   379 LRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLA 432
            |.|..::.|...|.:.     ..:.|::|..||.|     |    .|..|:.||
Zfish   268 LLISASIARCSDKVVW-----MARYLLELSLLEGR-----C----VVYLPAQLA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 13/77 (17%)
ccnpNP_001038424.1 Cyclin_N 136..259 CDD:278560 24/136 (18%)
Cyclin_C 264..384 CDD:281044 14/58 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.