DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccnj

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_021336586.1 Gene:ccnj / 557593 ZFINID:ZDB-GENE-100721-4 Length:355 Species:Danio rerio


Alignment Length:290 Identity:49/290 - (16%)
Similarity:99/290 - (34%) Gaps:96/290 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 SDELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLV 301
            ::::|:.|:         :..|.||....:......|...|.::..:...::|.......|:.|:
Zfish    13 AEDIYQALR---------YKELRLPAYKGQSPQLSLRRYFADLIAIVSNRFKLCPAARHLAVYLL 68

  Fly   302 DRFLDR--MAVKPKHM---ACMSVASFHLAIKQLDLKPIPAEDLVTISQCGC------------- 348
            |.|:||  ::|:..||   :|:.:||      :.:.:......|..::..||             
Zfish    69 DLFMDRYDISVQQLHMVALSCLLLAS------KFEEREDRVPKLEALNSLGCMSSMNLVLTKPGL 127

  Fly   349 -------------------TAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIG 394
                               .|..:|....|..|:..:..|. |:|.:....:|.:.:.:...|:.
Zfish   128 LHMELLLLETFQWNLYLPTAAHFIEYYLPVAVNETDLHDGW-PMTCMEKTMLYMSKYADYFLEVS 191

  Fly   395 ---GDFFKFYQQLI--------------------KLEELE--NRLEILMCDVKTTVITPSTLALV 434
               ..|.:|...|:                    :|:.|.  :..::|.|..|            
Zfish   192 LQDHAFLRFVPSLVSAACVASSRVILRLSPSWPPRLQRLSAYSWEQLLPCVQK------------ 244

  Fly   435 LICLHLDFHIKESYTR-----GSPELKHVF 459
            |:..| |..:||:..:     |:|..:.||
Zfish   245 LLIAH-DSDVKEANKQKCPPSGAPSTQTVF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 20/114 (18%)
ccnjXP_021336586.1 Cyclin_N2 <10..246 CDD:330468 40/260 (15%)
Cyclin_C 145..>249 CDD:308564 18/116 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.