DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccng2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_012817793.2 Gene:ccng2 / 549201 XenbaseID:XB-GENE-920883 Length:347 Species:Xenopus tropicalis


Alignment Length:338 Identity:100/338 - (29%)
Similarity:164/338 - (48%) Gaps:59/338 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 TSDELYETLKEYDV---LQDKFHTVLLLPKESRR---EVTAGGRDGSAYVLRCLK---MW----- 286
            ||:|.::.||:.::   |:.|:.     |:|...   |.||...:.....||..|   :|     
 Frog     4 TSNEAFKLLKQLNLHLELESKYQ-----PREKGLILIESTAENDNSICPRLRNAKVEDLWSLTNF 63

  Fly   287 YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLK-PIPA-EDLVTISQCGCT 349
            :.|..:....|::::||||..|.|||||::|:.|..|.||.|.::.. .||: .|::.||||.||
 Frog    64 FGLGMETFVLAVNILDRFLAIMKVKPKHLSCIGVCCFQLAAKVVEEDCNIPSVHDVIRISQCKCT 128

  Fly   350 AGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYAL---FRNLAKEIGGDFFKFYQQLIKLEELE 411
            ..|:.||..:|:.||..:.  ...|::::|.:|:.:   ..:..||:           :.|::||
 Frog   129 VSDMNRMEKIISEKLHFEF--KATTALTFLHLYHTVVLCHSSKRKEV-----------LNLDKLE 180

  Fly   412 NRLEILMCDVKTTVITPSTLALVLICLHLDFHIKESYTRGSPELKHVFEYILFLQQYMRIPDRVF 476
            .:|:...|.:..:...||.|||.|:.|.::       |..|.||   ||..|.:|::.::.|...
 Frog   181 AQLKACNCRLIFSKAKPSVLALCLLTLEVE-------TLKSLEL---FEIALRVQKHSKVNDEDM 235

  Fly   477 TCGFSIVSGILSHYNGQNKA-PYKQRLVWKLSSRTLRVLRPINRFSS--DLPTIEEGIPNALDDG 538
            .....:||..|:.|:..... |..::|||.:|.||.:.|.  |.:.|  :||||.|       .|
 Frog   236 LYWRELVSKCLADYSSPECCKPDHKKLVWTVSRRTAQNLH--NSYYSVPELPTIPE-------CG 291

  Fly   539 LRSRTESISSEEE 551
            ..:.:||..|.||
 Frog   292 RINESESEDSCEE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 32/79 (41%)
ccng2XP_012817793.2 CYCLIN_CCNG2 49..144 CDD:410287 36/94 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9962
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4856
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003985
OrthoInspector 1 1.000 - - otm47991
Panther 1 1.100 - - LDO PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2747
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.